KEGG   Streptococcus pneumoniae 670-6B: SP670_0834Help
Entry
SP670_0834        CDS       T01308                                 

Definition
arsenate reductase
Orthology
K00537  
arsenate reductase [EC:1.20.4.1]
Organism
snb  Streptococcus pneumoniae 670-6B
Brite
Enzymes [BR:snb01000]
 1. Oxidoreductases
  1.20  Acting on phosphorus or arsenic in donors
   1.20.4  With disulfide as acceptor
    1.20.4.1  arsenate reductase (glutaredoxin)
     SP670_0834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
779825..780181
Genome map
AA seq 118 aa AA seqDB search
MLEFIEYPKCSTCKKAKQELNQLGVDYKAVHIVEETPSQEVILNWLETSGFELKQFFNTS
GIKYRELGLKDKVGSLSNQEAAELLASDGMLLKRPILVENGTVKQIGYRKSYEELGLK
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgttagaatttatcgaataccccaaatgttcaacttgtaaaaaagcaaaacaagaatta
aatcaattaggtgtggactataaagccgtccatatcgtggaagaaacacctagccaagaa
gtcattttgaattggctagaaacctcaggatttgaattgaagcaatttttcaacaccagt
ggtatcaaataccgtgaattagggctaaaagataaggtaggaagtttgtcaaaccaagaa
gcggctgagttgctagcaagtgacggtatgttgttaaaacggcccattttagtagaaaat
ggaactgttaagcaaatcggttatcgaaaatcttatgaagaactgggactgaaatag

DBGET integrated database retrieval system