KEGG   Streptococcus pneumoniae 670-6B: SP670_0938Help
Entry
SP670_0938        CDS       T01308                                 

Definition
peptide methionine sulfoxide reductase MsrA/msrB (EC:1.8.4.11 1.8.4.12)
Orthology
K12267  
peptide methionine sulfoxide reductase msrA/msrB [EC:1.8.4.11 1.8.4.12]
Organism
snb  Streptococcus pneumoniae 670-6B
Brite
Enzymes [BR:snb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.11  peptide-methionine (S)-S-oxide reductase
     SP670_0938
    1.8.4.12  peptide-methionine (R)-S-oxide reductase
     SP670_0938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
870499..871437
Genome map
AA seq 312 aa AA seqDB search
MAEIYLAGGCFWGLEEYFSRISGVLETSVGYANGQVETTNYQLIKETDHAETVQVIYDEK
EVSLREILLYYFRVIDPLSINQQGNDRGRQYRTGIYYQDEADLPAIYTVVQEQERMLGRK
IAVEVEQLRHYILAEDYHQDYLRKNPSGYCHIDVTDADKPLIDAANYEKPSQEVLKASLS
EESYRVTQEAATEAPFTNAYDQTFEEGIYVDITTGEPLFFAKDKFASGCGWPSFSRPISK
ELIHYYKDLSHGMERIEVRSRSGSAHLGHVFTDGPRELGGLRYCINSASLRFVAKDEMEK
AGYGYLLPYLNK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaatttatctagcaggtggttgtttttggggcctagaggaatatttttcacgc
atttctggagtgctagaaaccagtgttggctacgctaatggtcaagtcgaaacgaccaat
taccagttgatcaaggaaacagaccatgcagaaacggtccaagtgatttacgatgagaag
gaagtgtcactcagagagattttactttattatttccgagttatcgatcctctatctatc
aatcaacaagggaatgaccgtggtcgccaatatcgaactgggatttattatcaggatgaa
gcagatttgccagctatctacacagtggtacaggagcaggaacgcatgctgggtcgaaag
attgcagtagaagtggagcaattacgccactacattctggctgaagactaccaccaagat
tatctcaggaagaatccttcaggttactgtcatatcgatgtgaccgatgctgataagcca
ttgattgatgcagcaaactatgaaaagcctagtcaagaggtgttgaaggccagtctatct
gaagagtcttatcgtgtcacacaagaagctgctacagaggctccgtttaccaatgcctat
gaccaaacctttgaagaggggatttatgtagatattacgacaggtgagccactctttttt
gccaaggataagtttgcttcaggttgtggttggccaagttttagccgtccgatttccaaa
gagttgattcattattacaaggatctgagccatggaatggagcgaattgaagttcgttct
cgttcaggcagtgctcacttgggtcatgttttcacagatggaccgcgggagttaggcggc
ctccgttactgtatcaattctgcttctttacgctttgtggccaaggatgagatggaaaaa
gcaggatatggctatctattgccttacttaaacaaataa

DBGET integrated database retrieval system