KEGG   Streptococcus pneumoniae 670-6B: SP670_0998Help
Entry
SP670_0998        CDS       T01308                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
snb  Streptococcus pneumoniae 670-6B
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snb00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SP670_0998 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SP670_0998 (pyrB)
Enzymes [BR:snb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     SP670_0998 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
921553..922476
Genome map
AA seq 307 aa AA seqDB search
MSENQQALNHVVSMEDLTVDQVMKLIKRGIEFKNGAQLPYEDHPIVSNLFFEDSTRTHKS
FEVAEIKLGLERLDFDVKTSSVNKGETLYDTILTLSALGVDVCVIRHPEVDYYRELIASP
TITTSIINGGDGSGQHPSQSLLDLMTIYEEFGHFEGLKVAIAGDLDHSRVAKSNMQILKR
LGAELFFAGPEEWRSQEFADYGKFVTIDEIIDQVDVMMFLRVQHERHDSGAVFSKEDYHA
QHGLTQERYDRLKETAILMHPAPINRDVEIADHLVEAPKSRIVQQMTNGVFVRMAILESV
LASRNAN
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaaatcaacaagcattgaaccatgtggtgtccatggaagacctcactgtcgat
caagtaatgaaattgatcaagcgaggaattgagtttaaaaatggagcccagcttccctat
gaagaccatccgattgtttccaatctcttctttgaggattctacacggacacataagtcc
tttgaagtcgcagagattaaacttggattggaacgacttgactttgatgtgaagactagt
tcggttaataagggtgagacactttatgacaccattttgactctgtctgctttaggagtg
gatgtctgtgtgattcgccatccagaggtcgactactatagagaattgattgctagtcca
acgattacgacttccatcatcaatggtggagatggttcgggtcaacaccctagccagagc
ttgcttgatttgatgaccatttatgaggaatttggccactttgagggtcttaaagttgct
attgcaggtgacttggaccactcacgcgttgccaaatccaatatgcagattttgaaacgc
ttgggagctgaactctttttcgctggacctgaggaatggagaagtcaagagtttgcagac
tatggaaagtttgtaaccattgatgaaatcattgatcaggttgatgtcatgatgtttctc
cgtgtgcaacacgaacgccatgatagtggagctgtattttcaaaagaagactaccatgcc
caacatggcttgactcaagaacgttacgatcgtttgaaagaaacagcaatcctcatgcac
ccagctccaatcaatcgtgatgtagaaatagcagaccacttggttgaagcaccaaaatca
cggattgtccaacaaatgaccaatggtgtctttgttcgaatggcaatcttagaatccgta
ctagcgagtagaaacgccaactaa

DBGET integrated database retrieval system