KEGG   Streptococcus pneumoniae 670-6B: SP670_1110Help
Entry
SP670_1110        CDS       T01308                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
snb  Streptococcus pneumoniae 670-6B
Pathway
snb00010  Glycolysis / Gluconeogenesis
snb00020  Citrate cycle (TCA cycle)
snb00620  Pyruvate metabolism
snb01100  Metabolic pathways
snb01110  Biosynthesis of secondary metabolites
snb01120  Microbial metabolism in diverse environments
snb01130  Biosynthesis of antibiotics
snb01200  Carbon metabolism
Module
snb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:snb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SP670_1110
   00020 Citrate cycle (TCA cycle)
    SP670_1110
   00620 Pyruvate metabolism
    SP670_1110
Enzymes [BR:snb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SP670_1110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding AATase
Motif
Other DBs
NCBI-ProteinID: ADM91173
Position
1030747..1031790
Genome map
AA seq 347 aa AA seqDB search
MADDKLRATPAARKLADDLGINLYDVSGSGANGRVHKEDVETYKDTNVVRISPLAKRIAL
EHNIAWQEIQGTGHRGKIMKKDVLALLPENIENDSIKSPAQIEKVEEVPDNVTPYGEIER
IPMTPMRKVIAQRMVESYLTAPTFTLNYEVDMTEMLALRKRVLEPIMEATGKKTTVTDLL
SLAVVKSLMKHPYINASLTEDGKTIITHNYVNLAMAVGMDNGLMTPVVYNAEKMSLSELV
VAFKDVIGRTLDGKLAPSELQNSTFTISNLGMFGVQSFGPIINQPNSAILGVSSTIEKPV
VVNGEIVIRPIMSLGLTIDHRVVDGMAGAKFMKDLKELIETPISMLI
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgacaagctaagagcgactcctgcagctagaaagttagcagatgatttaggg
ataaacctctacgacgtttctggctcaggtgcaaacggtcgtgtccacaaagaagacgtg
gaaacttataaagacacaaacgtggttcgcatttcgccacttgcaaaacgaattgccctc
gaacataacattgcttggcaggaaatccaaggaaccggtcatcgtggtaaaatcatgaag
aaggatgttttggccctgcttcctgaaaatatcgaaaacgatagcatcaaatctcctgct
cagattgaaaaagtggaagaagtccctgataacgtaacaccatatggtgaaatcgagcgt
attccaatgacaccaatgcgtaaggttattgcccaacgcatggttgaatcttacttgact
gcgccaaccttcaccctcaactatgaagttgatatgactgaaatgttggctcttcgtaag
agggttcttgagccaatcatggaagcaactgggaagaagactactgtaacagaccttctt
tcacttgcagttgttaagtctcttatgaaacatccatacatcaacgcttcattgacagaa
gatggcaagactattatcactcacaactatgtcaatcttgccatggcagttgggatggat
aatggattgatgacacctgttgtttacaatgctgagaagatgagtctttcagaactggtt
gtagcctttaaggatgttattggccgtaccttggatggtaaattggctccaagtgagtta
caaaattcaacattcacaatcagtaatttgggaatgtttggtgttcagtcctttggcccg
attattaaccaacccaactcagctatccttggtgtcagttcgacaatcgagaagccagtt
gtcgtcaatggtgaaattgtgattcgcccaatcatgagtttaggattaaccattgaccac
cgtgtcgtagatggtatggctggtgctaagtttatgaaggacttgaaagagttgattgaa
accccaatctcaatgttgatttaa

DBGET integrated database retrieval system