KEGG   Streptococcus pneumoniae 670-6B: SP670_1276Help
Entry
SP670_1276        CDS       T01308                                 

Definition
(GenBank) aminoglycoside 6'-N-acetyltransferase
  KO
K18816  
aminoglycoside 6'-N-acetyltransferase I [EC:2.3.1.82]
Organism
snb  Streptococcus pneumoniae 670-6B
Brite
Enzymes [BR:snb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.82  aminoglycoside 6'-N-acetyltransferase
     SP670_1276
Antimicrobial resistance genes [BR:snb01504]
 Gene variants
  Aminoglycoside resistance genes
   N-Acetyltransferases
    SP670_1276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1200607..1201035)
Genome map
AA seq 142 aa AA seqDB search
MDGITKDFIKTAKLMKQLWPQLTDKEAIDEVKKYTNGKNTAIFTEVEGDTIVGLALCSLR
FDYVEGCKYSPVGFLEGIIVDEEYRLKDIAKNLCTKCEEWAKNKGCKEFASDCTLTNTDS
IRFHLNIGFQEANRIIHFKKKL
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atggatggaataacaaaagattttataaaaacggctaaactaatgaaacaattatggccc
caattgaccgataaagaagctattgatgaagtaaaaaaatatacgaatggcaaaaatact
gcaatctttactgaagttgaaggtgacacaattgtaggtctagcactatgttcactcaga
tttgattatgttgaaggttgtaaatatagtcctgttggattcttagaagggattattgtt
gacgaggaatatcgtttaaaggatattgctaaaaatctctgtacaaaatgtgaggaatgg
gcgaaaaataaaggatgtaaggaatttgcaagtgactgtactttaacgaatacggattct
ataagatttcatctcaatattggatttcaggaggcaaatagaattattcattttaagaaa
aaattataa

DBGET integrated database retrieval system