KEGG   Streptococcus pneumoniae 670-6B: SP670_1283Help
Entry
SP670_1283        CDS       T01308                                 

Definition
(GenBank) conserved hypothetical protein
Organism
snb  Streptococcus pneumoniae 670-6B
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADM91344
Position
complement(1206808..1207374)
Genome map
AA seq 188 aa AA seqDB search
MVILELYQNDYSKDLVAFDSIEDGKAFVAQIPGYTLETEDGFEVEYFNPKNIPDYMEIIF
NGNIVPLSKFMFDPEENVNIIWKEISNLSLKNDRVIEGYSKIDAYVVNNHEVKAYVETRE
TNYRKAKDFLESRGYEIDRSFFGSEDGEAILYRKKGIEVWHFLCHLDPMFVEIEDVEGYV
KEEVGEIQ
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggttatattggaattgtaccaaaatgattattctaaagatttagtagcatttgattcc
atagaagatgggaaagcctttgtagctcaaatcccgggatacactctggaaacagaagat
ggttttgaagtggagtattttaatcctaaaaacataccggattatatggaaattattttt
aacggaaatattgttcctttatctaaatttatgttcgatcctgaggaaaatgtaaacatt
atttggaaagagatttcaaatttatccctcaaaaatgatagagtgatcgaaggatattca
aaaattgatgcatatgtcgttaacaaccatgaagttaaagcctatgtcgaaacaagagaa
acgaactatcgtaaagcaaaagacttcttagaaagccgcggatatgaaatcgacagaagc
tttttcggaagtgaagacggtgaagcgattctttacagaaaaaaagggatcgaagtttgg
catttcttgtgtcacttagacccaatgtttgtagagattgaagatgtagaaggatatgtt
aaagaagaagttggagagattcaatag

DBGET integrated database retrieval system