KEGG   Streptococcus pneumoniae 670-6B: SP670_1298Help
Entry
SP670_1298        CDS       T01308                                 

Definition
(GenBank) acetyltransferase, gnat family protein
Organism
snb  Streptococcus pneumoniae 670-6B
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1222141..1222572)
Genome map
AA seq 143 aa AA seqDB search
MLRDLQETDVKAICDINQETLGYTFSPEETASQLARLSQDSHHFLLGYEDAANHVLLGYV
HAEVYESLYSKAGFNILALAVSPQAQGQGIGKSLLQGLEQEAKRCGYGFIRLNSANHRLG
AHAFYEKVGYTCDKMQKRFIRIF
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgctaagagatttgcaagaaacagatgtgaaagcgatatgtgacatcaaccaagagact
ttgggttatacttttagtccagaggaaacggctagccaactagctagactgtctcaggat
tcccatcatttcctacttggctatgaggatgcagctaatcatgtcttacttggatatgtc
cacgctgaagtttacgaatcactctattccaaagcaggatttaatatcttagctttagca
gtttcacctcaagcgcaaggtcaaggtatcggtaaaagtttactacaagggttggaacaa
gaagccaaaagatgtggttatgggtttatccgcttaaattctgccaatcatcgtctgggt
gctcatgcattttatgaaaaagttggctatacttgtgataaaatgcagaaacggtttatt
cgcatcttttag

DBGET integrated database retrieval system