KEGG   Streptococcus pneumoniae 670-6B: SP670_1300Help
Entry
SP670_1300        CDS       T01308                                 

Gene name
hemK
Definition
(GenBank) protein-(glutamine-N5) methyltransferase, release factor-specific
  KO
K02493  
release factor glutamine methyltransferase [EC:2.1.1.297]
Organism
snb  Streptococcus pneumoniae 670-6B
Brite
Enzymes [BR:snb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.297  peptide chain release factor N5-glutamine methyltransferase
     SP670_1300 (hemK)
Translation factors [BR:snb03012]
 Eukaryotic Type
  Release factors
   SP670_1300 (hemK)
 Prokaryotic Type
   SP670_1300 (hemK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1223160..1223999)
Genome map
AA seq 279 aa AA seqDB search
MKLAQLFSNFEEELIRQGEEAESLSFVYRSLKNLSFTDFIFALQQEVTTEEEKQFVEDIY
QQLAAHKPAQYIIGQADFYGMHLKVDERVLIPRPETEELVELILTENLETNLSVLDIGTG
SGAIALALAKNRPDWSVTAADVSQEALELASENASDQNLNIFFKKSDCFAEISEKYDIIV
SNPPYISREDESEVGLNVLHSEPHLALFADEDGLAIYCRIAEDAKDYLKDGGKIYLEIGY
KQGQSVPELFRKHLPEKKVRTLKDQFGQDRMVVVDDGQD
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagctcaattattttcaaattttgaagaagagttgataagacaaggagaggaa
gcggaaagcctctcttttgtctatcgtagtctgaaaaatctatcttttacagactttatt
tttgccctccagcaggaggtgacaacagaggaagaaaaacaatttgtagaagatatttac
cagcaactagcagctcacaagccagctcagtacatcattggacaggcagatttttatgga
atgcatttaaaggtggatgaacgggttttgattcctcgtccagaaacagaggagttagtg
gagcttattctaactgaaaatcttgagacgaatctctcagttctggatattggaacaggt
agtggagctattgctctcgctctagcaaaaaatagaccagattggtcagtgacagcagca
gatgtttctcaagaggccttagagcttgcatcagagaatgctagcgatcaaaatcttaat
atattttttaaaaaatctgattgttttgcagaaatttctgaaaaatatgatataattgta
tccaatccaccctatatctctcgtgaagatgagtcagaggtaggcttgaatgttttgcat
tcggagcctcatctagctctctttgcagacgaggatggcctagctatttactgtagaatt
gcggaagatgcaaaagactatctcaaggatggtggtaagatttaccttgaaattggatac
aagcaaggtcaaagtgttcccgaactttttagaaaacatcttcctgaaaaaaaagttcga
acactcaaagaccaatttggtcaagataggatggtcgtggttgatgatggacaggattag

DBGET integrated database retrieval system