KEGG   Streptococcus pneumoniae 670-6B: SP670_1303Help
Entry
SP670_1303        CDS       T01308                                 

Definition
(GenBank) conserved domain protein
  KO
K01821  
4-oxalocrotonate tautomerase [EC:5.3.2.6]
Organism
snb  Streptococcus pneumoniae 670-6B
Pathway
Benzoate degradation
Xylene degradation
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:snb00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SP670_1303
   00622 Xylene degradation
    SP670_1303
   00621 Dioxin degradation
    SP670_1303
Enzymes [BR:snb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.2  Interconverting keto- and enol-groups
    5.3.2.6  2-hydroxymuconate tautomerase
     SP670_1303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1225788..1225970
Genome map
AA seq 60 aa AA seqDB search
MPFVRIDLFEGRTLEQKKALAKEVTEAVVRNTGAPQSAVHVIINDMPEGTYFPQGEMRTK
NT seq 183 nt NT seq  +upstreamnt  +downstreamnt
atgccatttgtacgcatcgatttatttgaaggacgcacgctcgagcaaaagaaagctctt
gctaaggaagtaacggaagcggttgttcgcaacactggagcacctcaatctgctgttcat
gtcatcatcaacgacatgccagaaggaacttatttcccacaaggggaaatgcgcaccaaa
taa

DBGET integrated database retrieval system