KEGG   Streptococcus pneumoniae 670-6B: SP670_1306Help
Entry
SP670_1306        CDS       T01308                                 

Gene name
asd
Definition
(GenBank) aspartate-semialdehyde dehydrogenase
  KO
K00133  
aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Organism
snb  Streptococcus pneumoniae 670-6B
Pathway
Glycine, serine and threonine metabolism
Monobactam biosynthesis
Cysteine and methionine metabolism
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:snb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SP670_1306 (asd)
   00270 Cysteine and methionine metabolism
    SP670_1306 (asd)
   00300 Lysine biosynthesis
    SP670_1306 (asd)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    SP670_1306 (asd)
Enzymes [BR:snb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.11  aspartate-semialdehyde dehydrogenase
     SP670_1306 (asd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
complement(1228517..1229593)
Genome map
AA seq 358 aa AA seqDB search
MGYTVAVVGATGAVGAQMIKMLEESTLSIDKIRYLASARSAGKSLKFKDQDITIEETTET
AFEGVDIALFSAGSSTSAKYAPYAVKAGVVVVDNTSYFRQNPDVPLVVPEVNAHALDAHN
GIIACPNCSTIQMMVALEPVRQKWGLDRIIVSTYQAVSGAGMGAILETQRELREVLNDGV
KPCDLHAEILPSGGDKKHYPIAFNALPQIDVFTDNDYTYEEMKMTKETKKIMEDDSIAVS
ATCVRIPVLSAHSESVYIETKEVAPIEEVKAAIAAFPGAVLEDDVAHQIYPQAINAVGSR
DTFVGRIRKDLDAEKGIHMWVVSDNLLKGAAWNSVQIAETLHERGLVRPTAELKFELK
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgggatatacagttgctgtagtcggcgcgacaggtgctgtcggtgctcagatgataaaa
atgttggaagaatcaacactttcaatcgataaaatccgttaccttgcttctgcacgttca
gcaggtaagtcattgaaatttaaagatcaagatattacaattgaagaaacgactgaaaca
gcttttgaaggagttgatattgctctcttttcagcaggtagttctacatcagctaagtat
gcaccatacgcagtaaaagctggcgtggtagtagtagataatacatcttatttccgtcaa
aatccagatgttcctttggttgttccagaggtcaatgctcatgcacttgatgctcacaac
ggaatcattgcctgccctaattgttcaacaatccaaatgatggtggctcttgagccggtt
cgccaaaaatggggcttggaccgtatcattgtttcaacttatcaagccgtttcaggtgct
ggtatgggagcaattcttgagacacaacgtgaacttcgtgaagtcttgaatgatggtgtg
aaaccatgtgatttgcatgcggaaattttgccttcaggtggtgacaagaaacattatcct
atcgcctttaacgctcttccacaaattgatgttttcactgataatgattacacgtacgaa
gagatgaagatgaccaaggaaactaagaaaattatggaagatgatagcattgcagtatct
gcaacatgtgtgcgtattccagtcttgtcagctcactctgagtctgtttatatcgaaaca
aaagaagtggctccaatcgaagaagtaaaagcagctatcgcagccttcccaggtgctgtt
cttgaagatgatgtagctcatcaaatctatcctcaagctatcaatgcagttggttcgcgt
gatacctttgttggtcgtatccgtaaagacttggatgcagaaaaaggaattcacatgtgg
gttgtttcagataaccttctcaaaggtgctgcttggaactcagttcagattgctgaaact
cttcatgaacgtggattggttcgtccaacagctgaattgaaatttgaattaaaatag

DBGET integrated database retrieval system