KEGG   Streptococcus pneumoniae 670-6B: SP670_1309Help
Entry
SP670_1309        CDS       T01308                                 

Gene name
mscL
Definition
(GenBank) large conductance mechanosensitive channel protein
  KO
K03282  
large conductance mechanosensitive channel
Organism
snb  Streptococcus pneumoniae 670-6B
Brite
Transporters [BR:snb02000]
 Other Transporters
  Pores ion channels [TC:1]
   SP670_1309 (mscL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
1231495..1231872
Genome map
AA seq 125 aa AA seqDB search
MLKNLKSFLLRGNVIDLAVGVVIASAFGAIVTSLVNDIITPLILNPALKAAKVERIAQLS
WHGVGYGNFLSAIINFIFVGTALFFIIKGIEKAQKLTGIKKEKTAEKKPTELEVLQEIKA
LLEKK
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaaatctaaaatcgttcttgcttcgaggaaatgttattgaccttgctgtcggt
gttgtaattgcctctgcttttggtgctatcgttacttcacttgtaaacgacattatcact
cctcttattttaaatcccgctttgaaagctgctaaagttgaacgtatcgctcaactttct
tggcatggagtcggctatggtaacttcttaagtgctattatcaattttatctttgtgggt
accgccctcttctttattatcaagggcattgaaaaagcacagaaactgactggcataaag
aaagaaaaaactgccgaaaaaaaaccaaccgaattggaagtccttcaagaaataaaagct
ctccttgagaaaaaataa

DBGET integrated database retrieval system