KEGG   Streptococcus pneumoniae 670-6B: SP670_1320Help
Entry
SP670_1320        CDS       T01308                                 

Definition
(GenBank) amino acid permease family protein
  KO
K03294  
basic amino acid/polyamine antiporter, APA family
Organism
snb  Streptococcus pneumoniae 670-6B
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1243734..1245125)
Genome map
AA seq 463 aa AA seqDB search
MNIFRTKNVSLDKTEMHRHLKLWDLILLGIGAMVGTGVFTITGTAAATLAGPALVISIVI
SALCVGLSALFFAEFASRVPATGGAYSYLYAILGEFPAWLAGWLTMMEFMTAISGVASGW
AAYFKGLLSQYGIALPQALNGTFNPQAGTFVDLLPILVLVLVTSLVLLNAKAALRFNSIL
VILKFSALALFVLVGIWNIKFDNWSNFAPYGFGQIYGASTGIMAGASLMFFGFLGFESIS
MAVDEVKTPQKNIPRGIVLSLSIVTILYALVTLVLTGVVHYSHLNVDDAVAFALRSVGIS
WAANYVSLVAILTLITVCISMTYALSRMIYSLARDGLVPAAFKELTKTSKVPKNATILTG
LASAVAAGMFPLASIAAFLNICTLAYLILLAYGLIRLRKEKGMPKAGEFKTPLVPLLPIL
SIIICLSFMLQYNMNTWIAFLVALLVGSIIYFTYGYKHSTIEE
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaatatatttagaacaaagaatgttagtttagataaaacagagatgcataggcatttg
aagttatgggatttgattttgctgggtatcggagccatggtagggacaggtgtttttaca
atcacaggtactgcagctgctacacttgctggtccagcactagtgatttcaatcgttatt
tctgccttgtgtgtgggattatcagccctcttttttgcagaatttgcctcgcgagtaccc
gctacaggaggtgcctatagttacctctatgctatcttaggagaattccctgcctggttg
gctggttggttaaccatgatggagttcatgacagccatatcaggcgtagcttcgggttgg
gcagcttattttaaaggcttgctctctcaatacgggatagcccttcctcaggctttaaat
ggtacctttaatcctcaagcagggacatttgttgatttattgcctattcttgtcttggtc
ttggtgacttcgcttgttttactaaatgccaaggcagccttacgctttaattcgattcta
gttattttgaaattttccgctttagctctctttgttttagtaggaatttggaatattaag
tttgataattggagcaattttgctccttacggttttggacaaatctatggagctagtact
ggtattatggctggtgcgtccttgatgttcttcggttttttgggatttgaatccatctct
atggctgtagatgaagtcaagactcctcaaaaaaatattcctagagggattgtcttatcg
ctttctatcgtaaccattctctatgccttggtgacccttgttttgactggtgtggttcac
tatagtcatttaaatgtcgatgatgccgttgcctttgcccttcgtagtgttgggattagt
tgggcagccaactatgtgtcattagtggctatcttgaccttgattacagtttgtatttcg
atgacctatgccctatcgcgtatgatttacagtttagcacgtgacggcttagtgcctgct
gcctttaaggaactgacgaagactagcaaggtaccaaagaatgctactatcttgacaggt
ctagcttcagcagtagcagcaggaatgttcccactagccagtattgcagcctttttaaat
atttgtaccttagcctacttgatcctgctggcttatggtctgattcgcttacggaaagaa
aaaggaatgcccaaagctggggaatttaaaacaccattggtacctctgttaccaatttta
tcgatcatcatttgtttatccttcatgttacagtataatatgaatacctggattgctttc
ctagttgcgttgttagtaggaagtattatttacttcacttatggctataagcattctacc
atagaagaataa

DBGET integrated database retrieval system