KEGG   Streptococcus pneumoniae 670-6B: SP670_1326Help
Entry
SP670_1326        CDS       T01308                                 

Definition
(GenBank) glycerophosphoryl diester phosphodiesterase family protein
  KO
K01126  
glycerophosphoryl diester phosphodiesterase [EC:3.1.4.46]
Organism
snb  Streptococcus pneumoniae 670-6B
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:snb00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SP670_1326
Enzymes [BR:snb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.46  glycerophosphodiester phosphodiesterase
     SP670_1326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1248675..1250438)
Genome map
AA seq 587 aa AA seqDB search
MKPEKPKKLGLKQIYLNLDKILFLFFLIFMIVEYLWVPFNSWLASFLLDQTGYLFISYNN
VLAILTHSPLISLAFLALIVINLLVAYFQIGLLFIGARHLLYNEKRRLIEYIRKVFHESF
GFMKKLTCAKALFIFFYIAMLFPFIRKMLKIYYLNKIVIPEFIQAYLEDKYWMWWLSILL
LSLIFLYVSVRLMFALPKIVYDQLTVREAVMFSLEKTKKRVTFYAWNLFYILLKAHLLFY
LPLIPLLLAQTLVDDITQRESLILGILNFVVIKNLYYMALTYFLVKFVSFLTGKELDMLP
RREKDHIVRWGVMTCASLFFALEGYIYLEAPMVHLPQLISHRGVSNANGIQNTVESLETT
AQLKPDLVETDVQETKDGQFVMMHDANLKNLAGINKSPQDLNLEELKGIDIFENGYQTKI
SSFEDYLSRANELGQKLLIEIKTSKKDSPDMMNRFLARYAAKLKIYGHQIQSLDYHVVEK
VRQYDAELPVYFIMPYNSVFPKTRATGYTMEYSTLDEYFVSKLWTTDQKLYVWTVNDSEA
ISKSLHLGVDGVITDDLEKVQREIEVAQEDPEYTDLLLKKALEFFEF
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctgaaaaacctaaaaaattgggtcttaaacagatttacctcaatcttgataaa
atcctctttctatttttcttgatttttatgatagtggagtatttgtgggtaccattcaat
tcatggttggctagcttcttattagatcagacaggttatctttttatttcctataacaat
gtcttagccatccttactcattctccattgattagtctagcttttttagccttgattgta
attaaccttctggttgcttattttcaaataggactcctctttattggtgctcgtcatctc
ctctataatgaaaagcgaaggctaattgagtatatccgcaaggttttccatgaaagtttt
ggatttatgaaaaagctaacttgcgctaaagccttgtttatctttttctatatagctatg
ctttttccttttatacggaaaatgctgaagatttattatcttaataaaatcgtcattcca
gagtttatccaagcttatttagaagataaatattggatgtggtggctgagcatcctactt
ctatctcttatctttctctatgtctctgtcagattgatgtttgcccttccgaagattgta
tatgatcagctgactgttcgagaagcagtgatgtttagcttggagaaaaccaagaagaga
gttactttttatgcttggaatttattttacatcttgctcaaagcacatttattattttat
cttcctttgattcctttattattggctcaaactttggtagatgatatcactcagagagag
tctctgattcttggtattttgaattttgtcgtgattaaaaatctctattatatggctctg
acttattttttggttaaatttgtttcatttttgacaggaaaggagctggatatgcttcct
aggagagaaaaagatcacatcgtgcgatggggtgtcatgacttgtgccagtcttttcttt
gccttagaaggttatatttatctggaggctcccatggttcatctacctcaacttatttct
caccgaggggtttccaatgcaaatgggattcaaaatacagtagagtccttggaaactaca
gcacaactcaaaccagacttggtggagacggacgtgcaggaaacaaaagatgggcagttt
gtcatgatgcatgatgctaacttgaaaaatctagcaggtatcaataaaagtcctcaagac
ttaaacttggaggagcttaaagggattgatatttttgaaaatggctaccagactaaaatt
tcaagctttgaagattatctcagtcgagccaacgaacttggtcaaaaattactaattgaa
attaaaaccagtaaaaaagatagtccagacatgatgaaccgctttttagcccgttatgct
gcaaagctcaagatttatggacatcaaatccagtctttagactaccatgttgtcgaaaaa
gtaagacagtatgatgccgaactgccagtttatttcatcatgccctacaattctgtcttt
cctaaaacaagagcgacaggatatactatggagtactcaaccttggatgaatattttgta
agcaaactatggacaacggatcagaaactttatgtctggactgtcaatgattcagaagct
atcagcaaatctcttcacttaggagtagatggagtgattacagatgatttggaaaaagtt
cagcgggaaatagaagtagcccaagaagatccagaatatacggatttgctcttgaaaaaa
gcattggaattctttgaattttag

DBGET integrated database retrieval system