KEGG   Streptococcus pneumoniae 670-6B: SP670_1341Help
Entry
SP670_1341        CDS       T01308                                 

Definition
(GenBank) oligoendopeptidase F
  KO
K08602  
oligoendopeptidase F [EC:3.4.24.-]
Organism
snb  Streptococcus pneumoniae 670-6B
Brite
Enzymes [BR:snb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     SP670_1341
Peptidases [BR:snb01002]
 Metallo Peptidases
  Family M3
   SP670_1341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1260589..1262391)
Genome map
AA seq 600 aa AA seqDB search
MVLQRNEINEKDTWDLSTIYPTDQAWEEALKDLTEQLETVAQYEGHLLDSADNLLEITEF
SLEMERQMEKLYVYAHMKNDQDTREAKYQEYYAKAMTLYSQLDQAFSFYEPEFMEISEKQ
YADFLEAQPKLQVYQHYFDKLLQGKDHVLSQREEELLAGAGEIFGSASETFSILDNADIV
FPYVLDDDGKEVQLSHGTYTRLMESKKREVRRGAYQALYATYEQFQHTYAKTLQTNVKVQ
NYRAKVRNYKSARHAALAANFVPESVYDNLVAAVRKHLPLLHRYLELRSKILGISDLKMY
DVYTPLSSVEYSFTYQEALKKAEDALAVLGEDYLSRVKRAFSERWIDVYENQGKRSGAYS
GGSYDTNAFMLLNWQDNLDNLFTLVHETGHSMHSSYTRETQPYVYGDYSIFLAEIASTTN
ENILTEKLLEEVEDDATRFAILNNFLDGFRGTVFRQTQFAEFEHAIHQADQNGEVLTSDF
LNKLYADLNQEYYGLSKEDNPEIQYEWARIPHFYYNYYVYQYSTGFAAASALAEKIVHGS
QEDRDRYIDYLKAGKSDYPLNVMRKAGVDMEKEDYLNDAFAVFERRLNEFEALVEKLGLA
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atggtattacaaagaaatgaaataaatgaaaaagatacatgggatctatcaacgatctac
ccaactgaccaggcttgggaagaagccttaaaagatttaacagaacaattggagacagta
gcccagtatgaaggccatctcttggatagtgcggataacctactagaaatcactgaattt
tctcttgaaatggaacgccagatggagaagctttacgtttatgctcatatgaagaatgac
caggatacacgtgaagctaagtatcaagagtactatgccaaggccatgacactctacagc
cagttagaccaagccttttcattctatgagcctgaatttatggagattagcgaaaagcag
tatgctgactttttagaagctcaaccaaagctgcaggtttatcaacactattttgacaag
ctcttgcaaggcaaggatcacgttctttcacaacgtgaagaagaattattggctggagct
ggagaaatctttggttcagcaagtgaaaccttctctatcttggacaatgcggatattgtg
ttcccttatgtcctagacgatgatggtaaagaagttcagctatctcatgggacttacaca
cgtttgatggagtctaaaaaacgtgaggttcgccgtggtgcctatcaagctctttatgcg
acttacgaacaattccaacacacctatgccaaaaccttgcaaaccaatgttaaggtgcaa
aattaccgtgctaaagttcgtaactacaagagtgctcgtcatgcagccctcgcagcgaat
tttgttccagaaagtgtttatgacaatttggtagcagcagttcgcaagcatttgccactc
ttacatcgctatcttgagcttcgttcaaaaatcttggggatttcagatctcaagatgtac
gatgtctacacaccgctttcatctgttgaatacagttttacctaccaagaagccttgaaa
aaagcagaagatgctttggcagtcttgggtgaggattacttgagccgtgtcaaacgtgcc
ttcagcgagcgttggattgatgtttacgaaaatcaaggcaagcgttcaggtgcctactct
ggtggttcttatgataccaatgcctttatgcttctcaactggcaggacaatctggacaat
ctctttactcttgttcatgaaacaggtcacagtatgcattcaagctatactcgtgaaact
cagccttatgtttacggagattactctatctttttggctgagattgcctcaactaccaat
gaaaatatcttgacggagaaattattggaagaagtggaagacgacgcaacacgctttgct
attctcaataacttcctagatggtttccgtggaacagttttccgccaaactcaatttgct
gagtttgaacacgccattcaccaagcagatcaaaatggggaggtcttgacaagcgatttc
ctaaataaactctacgcagacttgaaccaagagtattatggtttgagtaaggaagacaat
cctgaaatccaatacgagtgggctcgtattccacacttttactataactactatgtatat
caatattcaactggatttgcggccgcctcagccttggctgaaaaaattgtccatggtagt
caagaagaccgtgaccgctatatcgactacctcaaggcaggtaagtcggactatccactt
aatgtcatgagaaaagctggtgttgatatggagaaggaagactacctcaacgatgccttt
gcagtctttgaacgccgtttaaatgagtttgaagcccttgttgaaaaattaggattggca
taa

DBGET integrated database retrieval system