KEGG   Streptococcus pneumoniae 670-6B: SP670_1344Help
Entry
SP670_1344        CDS       T01308                                 

Gene name
smpB
Definition
(GenBank) SsrA-binding protein
  KO
K03664  
SsrA-binding protein
Organism
snb  Streptococcus pneumoniae 670-6B
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1264312..1264779)
Genome map
AA seq 155 aa AA seqDB search
MAKGEGKVVAQNKKARHDYTIVDTLEAGMVLTGTEIKSVRAARINLKDGFAQVKNGEVWL
SNVHIAPYEEGNIWNQEPERRRKLLLHKKQIQKLEQETKGTGMTLVPLKVYIKDGYAKLL
LGLAKGKHDYDKRESIKRREQNRDIARVMKAVNQR
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagggcgagggaaaggtcgtcgcacaaaataaaaaggcacgccacgactataca
atcgtagatacgctagaggcagggatggtcctgactggaactgaaatcaagagtgtacga
gctgctcgaattaatctcaaggatggctttgctcaagtgaaaaatggagaagtttggctg
agcaatgttcatatcgcgccttacgaagagggcaatatctggaaccaggaaccagaacgt
cgtcgtaaactcctgctccataaaaagcaaattcaaaaattggaacaagaaaccaaaggg
acaggaatgaccttagttccccttaaggtctatataaaagatggctacgctaagcttctt
ttaggacttgccaaagggaagcatgactatgacaaacgggagtctatcaaacgtcgtgag
caaaatcgagatatcgcgcgtgtgatgaaagctgttaatcagcgataa

DBGET integrated database retrieval system