KEGG   Streptococcus pneumoniae 670-6B: SP670_1348Help
Entry
SP670_1348        CDS       T01308                                 

Gene name
coaE
Definition
(GenBank) dephospho-CoA kinase
  KO
K00859  
dephospho-CoA kinase [EC:2.7.1.24]
Organism
snb  Streptococcus pneumoniae 670-6B
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Module
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:snb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SP670_1348 (coaE)
Enzymes [BR:snb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.24  dephospho-CoA kinase
     SP670_1348 (coaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1268806..1269411)
Genome map
AA seq 201 aa AA seqDB search
MRKIIGITGGIASGKSTVTNFLRQQGFQVVDADAVVHQLQKPGGRLFEALVQHFGQEIIL
ENGELNRPLLASLIFSNPEEQKWSKQIQGEIIREELATLREQLAQTEEIFFMDIPLLFEQ
DYSDWFAETWLVYVDRDTQVERLMKRDQLSKDEAEFRLAAQWPLEKKKDLASQVLDNNGN
QNQLLNQVHILLEGGRQDDRD
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaatcatcggaatcactgggggaattgcctctggtaagtcaactgtgacaaat
tttctaagacagcaaggctttcaagtagtggatgccgacgcagtcgtccaccaactacag
aaacctggtggtcgtctgtttgaggctctagtacagcactttgggcaagaaatcattctt
gaaaacggagaactcaatcgccctctcctagctagtctcatcttttcaaatcctgaagag
caaaaatggtctaagcaaattcaaggggagattatccgtgaggaactggctactttgaga
gaacagttggctcagacagaagagattttcttcatggatattcccctactttttgagcag
gactacagcgattggtttgctgagacttggttggtctatgtggaccgagatacccaagta
gaacgcttaatgaaaagggaccagttgtccaaagatgaagctgagtttcgtctggcagcc
cagtggcctttagaaaaaaagaaagatttggccagccaggttcttgataataatggcaat
cagaaccagcttcttaatcaagtgcatatccttcttgagggaggtaggcaagatgacaga
gattaa

DBGET integrated database retrieval system