KEGG   Streptococcus pneumoniae 670-6B: SP670_1349Help
Entry
SP670_1349        CDS       T01308                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
snb  Streptococcus pneumoniae 670-6B
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:snb03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1269411..1270235)
Genome map
AA seq 274 aa AA seqDB search
MPELPEVETVCRGLEKLIIGKKISSIEIRYPKMIKTDLEEFQRELPSQIIESMGRRGKYL
LFYLTDKVLISHLRMEGKYFYYPDQGPERKHAHVFFHFEDGGTLVYEDVRKFGTMELLVP
DLLDAYFISKKLGPEPSEQDFDLQVFQSALAKSKKPIKSHLLDQTLVAGLGNIYVDEVLW
RAQIHPARSSQTLTAEEATAIHDQTIAVLSQAVEKGGSTIRTYTNAFGEDGSMQDFHQVY
DKTGQECVRCGTIIEKIQLGGRGTHFCPNCQRRD
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattacctgaggttgaaaccgtttgtcgtggcttagaaaaattgattatagga
aagaagatttcgagtatagaaattcgctaccccaagatgattaagacggatttggaagag
tttcaaagggaattgcctagtcagattatcgagtcaatgggacgtcgtggaaaatatttg
cttttttatctgacagacaaggtcttgatttcccatttgcggatggagggcaagtatttt
tactatccagaccaaggacctgaacgcaagcatgcccatgttttctttcattttgaagat
ggtggcacgcttgtttatgaggatgttcgcaagtttggaaccatggaactcttggtgcct
gaccttttagacgcctactttatttctaaaaaattaggtcctgaaccaagcgaacaagac
tttgatttacaggtctttcaatctgcccttgccaagtccaaaaagcctatcaaatcccat
ctcctagaccagaccttggtagctggacttggcaatatctatgtggatgaggttctctgg
cgagctcagattcatccagctagatcttcccagactttgacagcagaagaagcgacagct
attcatgaccaaaccattgctgttttgagccaggctgttgaaaaaggcggttccaccatt
cggacctataccaatgcctttggggaagatggaagcatgcaggattttcatcaggtctat
gataagactggtcaagaatgtgtacgctgtggtaccatcattgagaaaattcaactaggc
ggacgaggcacccacttttgtccaaactgtcaaaggagggactga

DBGET integrated database retrieval system