KEGG   Streptococcus pneumoniae 670-6B: SP670_1350Help
Entry
SP670_1350        CDS       T01308                                 

Gene name
era
Definition
(GenBank) GTP-binding protein Era
  KO
K03595  
GTPase
Organism
snb  Streptococcus pneumoniae 670-6B
Brite
Ribosome biogenesis [BR:snb03009]
 Eukaryotic Type
  Other ribosome biogenesis factors
   SP670_1350 (era)
 Prokaryotic Type
  GTPases
   SP670_1350 (era)
Mitochondrial biogenesis [BR:snb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SP670_1350 (era)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1270284..1271183)
Genome map
AA seq 299 aa AA seqDB search
MTFKSGFVAILGRPNVGKSTFLNHVMGQKIAIMSDKAQTTRNKIMGIYTTDKEQIVFIDT
PGIHKPKTALGDFMVESAYSTLREVDTVLFMVPADEARGKGDDMIIERLKAAKVPVILVV
NKIDKVHPDQLLSQIDDFRNQMDFKEIVPISALQGNNVSRLVDILSENLDEGFQYFPSDQ
ITDHPERFLVSEMVREKVLHLTREEIPHSVAVVVDSMKRDEETDKVHIRATIMVERDSQK
GIIIGKGGAMLKKIGSMARRDIELMLGDKVFLETWVKVKKNWRDKKLDLADFGYNEKEY
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgacttttaaatcaggctttgtagccattttaggacgtcccaatgttgggaagtcaacc
tttttaaatcacgttatggggcaaaagattgccatcatgagtgacaaggcgcagacaacg
cgcaataaaatcatgggaatttacacgactgataaggagcaaattgtctttatcgacaca
ccagggattcacaaacctaaaacagctctcggagatttcatggttgagtctgcctacagt
acccttcgcgaagtggacaccgttcttttcatggtgcctgctgatgaagcgcgtggtaag
ggggacgatatgattatcgagcgtctcaaggctgccaaggttcctgtgattttggtggtg
aataaaatcgataaggtccatccagaccagctcttgtctcagattgatgacttccgtaat
caaatggactttaaggaaattgttccaatctcagcccttcagggaaataacgtgtctcgt
ctagtggatattttgagtgaaaatctggatgaaggtttccaatatttcccgtctgatcaa
atcacagaccatccagaacgtttcttagtttcagaaatggttcgcgagaaagtcttgcac
ctaactcgtgaagagattccgcattctgtagcagtagttgttgactctatgaaacgagac
gaagagacagacaaggttcacatccgtgcaaccatcatggtcgagcgcgatagccaaaaa
gggattatcatcggtaaaggtggcgctatgcttaagaaaatcggtagcatggcccgtcgt
gatatcgaactcatgctaggagacaaggtcttcctagaaacctgggtcaaggtcaagaaa
aactggcgcgataaaaagctagatttggctgactttggctataatgaaaaagaatactaa

DBGET integrated database retrieval system