KEGG   Streptococcus pneumoniae 670-6B: SP670_1351Help
Entry
SP670_1351        CDS       T01308                                 

Definition
(GenBank) diacylglycerol kinase
  KO
K00887  
undecaprenol kinase [EC:2.7.1.66]
Organism
snb  Streptococcus pneumoniae 670-6B
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:snb00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SP670_1351
Enzymes [BR:snb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.66  undecaprenol kinase
     SP670_1351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1271200..1271595)
Genome map
AA seq 131 aa AA seqDB search
MDSQDNKRKWKNRDLISSLEFAITGIFTAIKEERNMRKHAVTALVVILAGFVFQVSRIEW
LFLLLSIFLVVAFEIINSAIENVVDLASHYHFSMLAKNAKDMAAGAVLVVSLFAALTGAL
IFLPRIWDLLF
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggactcacaagacaataaacgaaaatggaaaaatcgtgacttgatatccagtttagaa
tttgccatcacagggatttttactgctatcaaggaagaacgcaatatgcgaaaacatgca
gtgacggctctagtggtcatccttgcaggttttgtttttcaggtgtcacgaatcgaatgg
ctctttcttctattgagtattttcttggtagtagcctttgagattatcaactctgctatt
gaaaatgtggtggatttggccagtcattatcacttttccatgctggctaaaaatgccaag
gatatggcggccggcgcggtattagtggtttctcttttcgcagccttaacaggcgcattg
atttttctcccacgaatctgggatttattattttaa

DBGET integrated database retrieval system