KEGG   Streptococcus pneumoniae 670-6B: SP670_1354Help
Entry
SP670_1354        CDS       T01308                                 

Definition
(GenBank) endo-beta-N-acetylglucosaminidase
  KO
K01227  
mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase [EC:3.2.1.96]
Organism
snb  Streptococcus pneumoniae 670-6B
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:snb00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SP670_1354
Enzymes [BR:snb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.96  mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
     SP670_1354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
complement(1273894..1276002)
Genome map
AA seq 702 aa AA seqDB search
MKKVRFIFLALLFFLASPEGAMASDGTWQGKQYLKEDGSQAANEWVFDTHYQSWFYIKAD
ANYAENEWLKQGDDYFYLKSGGYMAKSEWVEDKGAFYYLDQDGKMKRNAWVGTSYVGATG
AKVIEDWVYDSQYDAWFYIKADGQHAEKEWLQIKGKDYYFKSGGYLLTSQWINQAYVNAS
GAKVQQGWLFDKQYQSWFYIKENGNYADKEWIFENGHYYYLKSGGYMAANEWIWDKESWF
YLKFDGKIAEKEWVYDSHSQAWYYFKSGGYMAANEWIWDKESWFYLKFDGKMAEKEWVYD
SHSQAWYYFKSGGYMTANEWIWDKESWFYLKSDGKIAEKEWVYDSHSQAWYYFKSGGYMT
ANEWIWDKESWFYLKSDGKMAEKEWVYDSHSQAWYYFKSGGYMAKNETVDGYQLGSDGKW
LGGKATNENAAYYQVVPVTANVYDSDGEKLSYISQGSVVWLDKDRKSDDKRLAITISGLS
GYMKTEDLQALDASKDFIPYYESDGHRFYHYVAQNASIPVASHLSDMEVGKKYYSADGLH
FDGFKLENPFLFKDLTEATNYSAEELDKVFSLLNINNSLLENKGATFKEAEEHYHINALY
LLAHSALESNWGRSKIAKDKNNFFGITAYDTTPYLSAKTFDDVDKGILGATKWIKENYID
RGRTFLGNKASGMNVEYASDPYWGEKIASVMMKINEKLGGKD
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagtaagatttatttttttagctctgctatttttcttagctagtccagagggt
gcaatggctagtgatggtacttggcaaggaaaacagtatctgaaagaagatggcagtcaa
gcagcgaatgagtgggtttttgatactcattatcaatcttggttctatataaaagcagat
gctaactatgctgaaaatgaatggctaaagcaaggtgacgactatttttacctcaaatct
ggtggctatatggccaaatcagaatgggtagaagacaagggagccttttattatcttgac
caagatggaaagatgaaaagaaatgcttgggtaggaacttcctatgttggtgcaacaggt
gccaaagtaatagaagactgggtctatgattctcaatacgatgcttggttttatatcaaa
gcagatggacagcacgcagagaaagaatggctccaaattaaagggaaggactattatttc
aaatccggtggttatctactgacaagtcagtggattaatcaagcttatgtgaatgctagt
ggtgccaaagtacagcaaggttggctttttgacaaacaataccaatcttggttttacatc
aaagaaaatggaaactatgctgataaagaatggattttcgagaatggtcactattattat
ctaaaatccggtggctacatggcagccaatgaatggatttgggataaggaatcttggttt
tatctcaaatttgatgggaaaatagctgaaaaagaatgggtctacgattctcatagtcaa
gcttggtactacttcaaatccggtggctacatggcagccaatgaatggatttgggataag
gaatcttggttttacctcaagtttgatggcaaaatggctgaaaaagaatgggtctacgat
tctcatagtcaagcctggtattacttcaaatccggtggttacatgacagccaatgaatgg
atttgggataaggaatcttggttttatctcaaatctgatgggaaaatagctgaaaaagaa
tgggtctacgattctcatagtcaagcttggtactacttcaaatccggtggttacatgaca
gccaatgaatggatttgggataaggaatcttggttttacctcaagtctgatggcaaaatg
gctgaaaaagaatgggtctacgattctcatagtcaagcctggtactacttcaaatctggt
ggctacatggcgaaaaatgagacagtagatggttatcagcttggaagcgatggtaaatgg
cttggaggaaaagctacaaatgaaaatgctgcttactatcaagtagtgcctgttacagcc
aatgtttatgattcagatggtgaaaagctttcctatatatcgcaaggtagtgtcgtatgg
ctagataaggatagaaaaagtgatgacaagcgcttggctattactatttctggtttgtca
ggctatatgaaaacagaagatttacaagcgctagatgctagtaaggactttatcccttat
tatgagagtgatggccaccgtttttatcactatgtggctcagaatgctagtatcccagta
gcttctcatctttctgatatggaagtaggcaagaaatattattcggcagatggcctgcat
tttgatggttttaagcttgagaatcccttccttttcaaagatttaacagaggctacaaac
tacagtgctgaagaattggataaggtatttagtttgctaaacattaacaatagccttttg
gagaacaagggcgctacttttaaggaagccgaagaacattaccatatcaatgctctttat
ctccttgcccatagtgccctagaaagtaactggggaagaagtaaaattgccaaagataag
aataatttctttggcattacagcctatgatacgaccccttacctttctgctaagacattt
gatgatgtggataagggaattttaggtgcaaccaagtggattaaggaaaattatatcgat
aggggaagaactttccttggaaacaaggcttctggtatgaatgtggaatatgcttcagac
ccttattggggcgaaaaaattgctagtgtgatgatgaaaatcaatgagaagctaggtggc
aaagattag

DBGET integrated database retrieval system