KEGG   Streptococcus pneumoniae 670-6B: SP670_1357Help
Entry
SP670_1357        CDS       T01308                                 

Definition
(GenBank) lactoylglutathione lyase
  KO
K01759  
lactoylglutathione lyase [EC:4.4.1.5]
Organism
snb  Streptococcus pneumoniae 670-6B
Pathway
Pyruvate metabolism
Brite
KEGG Orthology (KO) [BR:snb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SP670_1357
Enzymes [BR:snb01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.5  lactoylglutathione lyase
     SP670_1357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1278100..1278480)
Genome map
AA seq 126 aa AA seqDB search
MASKMLHTCLRVENLEKSIAFYQDAFGFKELRRRDFPDHAFTIVYLGLEGDDYELELTYN
YDHGPYVVGDGFAHIALSTPDLEALHQEHSAKGYEVTEPNGLPGTTPNYYFVKDPDGYKV
EVIREK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaaaaatgctacacacttgcttacgagtagaaaatcttgaaaaatcaatcgca
ttttatcaagatgcttttggttttaaagaattgcgtcgcagagattttccagaccatgcc
ttcacgattgtctatctaggtcttgagggtgatgattatgagttggagttgacttataac
tacgatcacggtccgtatgtggttggtgatgggtttgcccatatcgctctcagtacacct
gatcttgaggcacttcatcaagaacacagtgcaaaaggctatgaagtgactgagccaaat
ggtctaccaggaactacaccaaactattactttgtcaaagaccctgatggatataaggtc
gaagtcattcgtgaaaaataa

DBGET integrated database retrieval system