KEGG   Streptococcus pneumoniae 670-6B: SP670_1358Help
Entry
SP670_1358        CDS       T01308                                 

Gene name
rplT
Definition
(GenBank) ribosomal protein L20
  KO
K02887  
large subunit ribosomal protein L20
Organism
snb  Streptococcus pneumoniae 670-6B
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:snb00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    SP670_1358 (rplT)
Ribosome [BR:snb03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    SP670_1358 (rplT)
  Bacteria
    SP670_1358 (rplT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1278538..1278897)
Genome map
AA seq 119 aa AA seqDB search
MARVKGGVVSRKRRKRILKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL
WITRINAAARMNGLSYSQLMHGLKLAEIEVNRKMLADLAVNDAVAFTALADAAKAKLGK
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtgttaaaggtggcgttgtatcacgcaaacgtcgtaaacgtattcttaaatta
gcaaaaggttactatggagctaaacacatcttattccgtactgcaaaagaacaagtaatg
aactcttactactatgcataccgtgaccgtcgtcagaaaaaacgtgacttccgcaaattg
tggattactcgtatcaatgcggcagctcgtatgaacggactttcatactcacaattgatg
catggtttgaaattggctgagattgaagttaaccgtaaaatgcttgctgacttggctgtt
aacgatgcagtagctttcacagctcttgcagatgcagctaaagcaaaacttggtaaataa

DBGET integrated database retrieval system