KEGG   Streptococcus pneumoniae 670-6B: SP670_1359Help
Entry
SP670_1359        CDS       T01308                                 

Gene name
rpmI
Definition
(GenBank) ribosomal protein L35
  KO
K02916  
large subunit ribosomal protein L35
Organism
snb  Streptococcus pneumoniae 670-6B
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:snb00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    SP670_1359 (rpmI)
Ribosome [BR:snb03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    SP670_1359 (rpmI)
  Bacteria
    SP670_1359 (rpmI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1278949..1279149)
Genome map
AA seq 66 aa AA seqDB search
MPKQKTHRASAKRFKRTGSGGLKRFRAYTSHRFHGKTKKQRRHLRKASMVHSGDYKRIKA
MLTRLK
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaacaaaaaacacaccgcgcatcagctaaacgtttcaaacgtacaggttctggt
ggacttaaacgtttccgtgcttacacttctcaccgtttccacggaaaaactaagaaacaa
cgtcgtcatcttcgtaaagcatctatggtgcattcaggagattacaaacgtatcaaagca
atgcttactcgcttgaaataa

DBGET integrated database retrieval system