KEGG   Streptococcus pneumoniae 670-6B: SP670_1365Help
Entry
SP670_1365        CDS       T01308                                 

Definition
(GenBank) competence protein
  KO
K02237  
competence protein ComEA
Organism
snb  Streptococcus pneumoniae 670-6B
Module
Competence-related DNA transformation transporter
Brite
Secretion system [BR:snb02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components [MD:M00429]
   SP670_1365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1284422..1285072)
Genome map
AA seq 216 aa AA seqDB search
MEAIIEKIKEYKIIVICTGLGLLVGGFFLLKPAPQTPVKETNLQAEVAAVSKDLVSEKEV
NKEEKEEPLEQDLITVDVKGAVKSPGIYDLPVGSRVNDAVQKAGGLTEQADSKSLNLAQK
VSDEALVYVPTKGEEAVSQQTGLGTASSISKEKKVNLNKASLEELKQVKGLGGKRAQDII
DHREANGKFKSVDELKKVSGIGGKTIEKLKDYVTVD
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaattatcgagaaaatcaaagagtataaaatcatcgtcatctgtactggtctg
ggcttgcttgtaggaggatttttcctgctaaaaccagctccacaaacacctgtcaaagag
acgaatttgcaggctgaagtcgcagctgtttccaaggatttggtatccgaaaaggaagtg
aacaaggaagaaaaggaagaaccccttgaacaagatctaatcacagtagatgtcaaaggt
gctgtcaaatcgccagggatttatgacttgcctgtaggtagtcgagtcaatgatgctgtt
cagaaggctggtggcttgacagagcaagcagacagcaagtcgctcaatctagctcagaaa
gttagtgatgaggctctggtttacgttcctactaagggagaagaagcagttagccaacag
actggtttggggacagcttcttcaataagcaaggaaaagaaggtcaatctcaacaaggcc
agtctggaagaactcaagcaggtcaagggactgggaggaaaacgagctcaggacattatc
gaccatcgtgaggcaaatggcaagttcaagtcagtagacgagctcaagaaggtctctggc
attggtggcaaaacaatagaaaagcttaaagactatgttacagtggattaa

DBGET integrated database retrieval system