KEGG   Streptococcus pneumoniae 670-6B: SP670_1372Help
Entry
SP670_1372        CDS       T01308                                 

Definition
(GenBank) hypothetical protein
Organism
snb  Streptococcus pneumoniae 670-6B
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
Position
1288162..1288341
Genome map
AA seq 59 aa AA seqDB search
MTQEDALIVISHIKVLSIVPNRCLKPLDKTFSLYNWIFLSQKYILLQANFLKISRVQLQ
NT seq 180 nt NT seq  +upstreamnt  +downstreamnt
atgacacaggaagatgcactgatcgtcatcagccacataaaagttctttccatcgtgcct
aatcgttgtctcaaacctttggataaaacctttagcctatacaactggattttcctctct
caaaagtatattcttttgcaggcgaacttcctcaaaatcagtcgtgtgcaacttcagtag

DBGET integrated database retrieval system