KEGG   Streptococcus pneumoniae 670-6B: SP670_1373Help
Entry
SP670_1373        CDS       T01308                                 

Definition
(GenBank) PhoH family protein
  KO
K06217  
phosphate starvation-inducible protein PhoH and related proteins
Organism
snb  Streptococcus pneumoniae 670-6B
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1288319..1289287)
Genome map
AA seq 322 aa AA seqDB search
MKEHSIDIQLSHPDDLFHLFGSNERHLRLMEEELDVVIHARTEIVQVLGEESACEEARQV
IQALMALVNRGMTVGTPDVVTAISMVKNDEIDKFVALYEEEIIKDNTGKPIRVKTLGQKL
YVDSVKQHDVTFGIGPAGTGKTFLAVTLAVTALKRGQVKRIILTRPAVEAGESLGFLPGD
LKEKVDPYLRPVYDALYQILGKDQTTRLMEREIIEIAPLAYMRGRTLDDAFVILDEAQNT
TIMQMKMFLTRLGFHSKMIVNGDISQIDLPRNVKSGLIDAQEKLKNIHQIDFVHFSAKDV
VRHPVVAQIIRAYEYSTEVAHD
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggaacattcaatagacattcaactgagtcatccagatgacctgtttcatcttttt
ggttccaatgaacgccatcttcgtttgatggaagaagagcttgatgttgtgattcatgct
cgtacggagattgtccaggttttgggagaagagtctgcttgcgaggaagcccgtcaggtt
attcaagctctcatggccttggtaaatcgtgggatgaccgttggtacgccagatgtagtg
acggctattagtatggtcaaaaatgatgaaattgacaagtttgtcgccctttacgaagaa
gaaatcatcaaggataatactgggaagcctatccgcgtcaaaaccttaggtcaaaaactt
tatgtggacagtgtcaaacagcatgatgtgacctttggaattgggccggcaggtacaggg
aagaccttccttgcagtgaccttggcagtgactgcccttaaacgtgggcaagtcaagcga
attatcctaactcgtccagcggtggaagcgggagagagtcttggatttcttccgggtgat
cttaaggagaaggtggatccttaccttcgtcctgtttacgatgccttgtatcaaattctt
gggaaagaccaaacgactcgtctcatggagcgtgaaattatcgaaattgcgccccttgcc
tatatgcgtggccggaccttggatgatgcctttgtcattctcgatgaggcgcaaaacacg
accatcatgcagatgaagatgttcttgacgcgtttaggctttcattctaagatgattgtc
aatggagatatcagtcagattgacctgccacgtaatgtcaagtccggtttgattgatgct
caagagaaactcaagaacatccatcagattgactttgttcatttttcagctaaggatgtg
gttcgccatccagttgtcgctcaaattatccgagcctatgaatattctactgaagttgca
cacgactga

DBGET integrated database retrieval system