KEGG   Streptococcus pneumoniae 670-6B: SP670_1384Help
Entry
SP670_1384        CDS       T01308                                 

Definition
(GenBank) initiation-control protein YabA
Organism
snb  Streptococcus pneumoniae 670-6B
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1296892..1297209)
Genome map
AA seq 105 aa AA seqDB search
MDKKELFDALDDFSQQLLVTLADVEAIKKNLKSLVEENTALRLENSKLRERLGEVEADAP
VKAKHVRESVRRIYRDGFHVCNDFYGQRREQDEECMFCDELLYRE
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaaaagaattatttgacgcgctggatgatttttcccaacaattattggtaacc
ttagccgatgtggaagccatcaagaaaaatctcaagagcttggtagaagaaaatacagct
cttcgcttggaaaatagtaagttgcgagaacgcttgggtgaggtggaagcagacgctccc
gtcaaggccaagcatgttcgcgaaagtgtccgtcgcatttaccgtgatggatttcacgta
tgtaatgatttttatggacaacgtcgagagcaggacgaagaatgtatgttctgtgatgag
ttgttatacagggagtaa

DBGET integrated database retrieval system