KEGG   Streptococcus pneumoniae 670-6B: SP670_1390Help
Entry
SP670_1390        CDS       T01308                                 

Definition
(GenBank) choline binding protein E
Organism
snb  Streptococcus pneumoniae 670-6B
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
complement(1302277..1304160)
Genome map
AA seq 627 aa AA seqDB search
MKKKLTSLALVGAFLGLSWYGNVQAQESSGNKIHFINVQEGGSDAIILESNGHFAMVDTG
EDYDFPDGSDSRYPWREGIETSYKHVLTDRVFRRLKELGVQKLDFILVTHTHSDHIGNVD
ELLSTYPVDRVYLKKYSDSRITNSERLWDNLYGYDKVLQTAAEKGVSVIQNITQGDAHFQ
FGDMDIQLYNYENETDSSGELKKIWDDNSNSLISVVKVNGKKIYLGGDLDNVHGAEDKYG
PLIGKVDLMKFNHHHDTNKSNTKDFIKNLSPSLIVQTSDSLPWKNGVDSEYVNWLKERGI
ERINAASKDYDATVFDIRQDGLVNISTSYKPIPSFQAGWHKSAYGNWWYQAPDSTGEYAV
GWNEIEGEWYYFNQTGILLQNQWKKWNNHWFYLTDSGASAKNWKKIDGIWYYFNKENQME
IGWVQDKEQWYYLDVDGSMKTGWLQYMGQLYYFAPSGEMKTGWVKDKEAWYYMDSTGIMK
TGEIEVAGHHYYLEESGAMKQGWLKKANDWYFYKTGGSRAIGWIKDKDKWYFLKENGQLL
VNGKTPEGYTVDSSGAWLVDVPIEKSATIKTTSHSEIKESKEVVKKDLENKETSQHESVT
NSSTSQDLTSSTSQSSETSVNKSESEQ
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaattaactagtttagcacttgtaggcgcttttttaggtttgtcatggtat
gggaatgttcaggctcaagaaagttcaggaaataaaatccactttatcaatgttcaagaa
ggtggcagtgatgcgattattcttgaaagcaatggacattttgccatggtggatacagga
gaagattatgatttcccagatggaagtgattctcgctatccatggagagaaggaattgaa
acgtcttataagcatgttctaacagaccgtgtctttcgtcgtttgaaggaattgggtgtc
caaaaacttgattttattttggtgacccatacccacagtgatcatattggaaatgttgat
gaattactgtctacctatccagttgaccgagtctatcttaagaaatatagtgatagtcgt
attactaattctgaacgtctatgggataatctgtatggctatgataaggttttacagact
gctgcagaaaaaggtgtttcagttattcaaaatatcacacaaggggatgctcattttcag
tttggggacatggatattcagctctataattatgaaaatgaaactgattcatcgggtgaa
ttaaagaaaatttgggatgacaattccaattccttgattagcgtggtgaaagtcaatggc
aagaaaatttaccttgggggcgatttagataatgttcatggagcagaagacaagtatggt
cctctcattggaaaagttgatttgatgaagtttaatcatcaccatgataccaacaaatca
aataccaaggatttcattaaaaatttgagtccgagtttgattgttcaaacttcggatagt
ctaccttggaaaaatggtgttgatagtgagtatgttaattggctcaaagaacgaggaatt
gagagaatcaacgcagccagcaaagactatgatgcaacagtttttgatattcgacaagac
ggtttagtaaacatttcaacttcctacaagccgattccaagttttcaagctggttggcat
aagagtgcatatgggaactggtggtatcaagcgcctgattctacaggagagtatgctgtc
ggttggaatgaaatcgaaggtgaatggtattactttaaccaaacgggtatcttgttacag
aatcaatggaaaaaatggaacaatcattggttctatttgacagactctggtgcttctgct
aaaaattggaagaaaattgatggaatctggtattattttaacaaagaaaatcagatggaa
attggttgggttcaagataaagagcagtggtattatttggatgttgatggttctatgaag
acaggatggcttcaatatatggggcaattgtattactttgctccatcaggggaaatgaaa
acgggctgggtaaaagataaagaagcctggtactatatggattctactggtatcatgaag
acaggtgagatagaagttgctggacatcattactatctagaagaatcaggagctatgaag
caaggctggcttaaaaaggcaaatgattggtatttctacaagacaggtggttcacgagct
ataggttggattaaagacaaggataaatggtacttcttgaaagaaaatggtcaattactt
gtgaatggtaagacaccagaaggctatactgtggattcaagtggtgcctggttagtggat
gttccgatcgagaaatctgctacaattaaaactacaagtcattcagaaataaaagaatcc
aaagaagtagtgaaaaaggatcttgaaaataaagaaacaagtcaacatgaaagtgttaca
aattcttcaactagtcaagatttgacatcctcaacttcacaaagctctgaaacgagtgta
aacaaatcggaatcagaacagtag

DBGET integrated database retrieval system