KEGG   Streptococcus pneumoniae 670-6B: SP670_1393Help
Entry
SP670_1393        CDS       T01308                                 

Definition
(GenBank) transcriptional regulator, LysR family
Organism
snb  Streptococcus pneumoniae 670-6B
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1305498..1306406)
Genome map
AA seq 302 aa AA seqDB search
MNIQQLRYVVAIANSGTFREAAEKMYVSQPSLSISVRDLEKELGFKIFRRTSSGTFLTRR
GMEFYEKSQELVKGFDIFQNQYANPEEEKDEFSVASQHYDFLPPTITAFSERYPDYKNFR
IFESTTVQILDEVAQGHSEIGIIYLNNQNKKGIMQRVEKLGLEVIELIPFHTHIYLREGH
PLAQKEELVMEDLADLPTVRFTQEKDEYLYYSENFVDTSASSQMFNVTDRATLNGILERT
DAYATGSGFLDSDSVNGITVIRLKDNLDNRMVYVKREEVELSQAGTLFVEVMQEYFDQKR
KS
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcaacaattacgctatgttgttgccattgccaatagtggtactttccgtgaa
gctgctgaaaagatgtatgttagtcagccgagtctgtctatttctgttcgtgatttggaa
aaagagttgggttttaagattttccgtcggaccagctcagggactttcttgacccgtcgt
gggatggaattctatgaaaaatcgcaagaattggttaaaggatttgatatttttcaaaat
cagtatgccaatcctgaagaagaaaaagatgaattttctgttgctagccagcactatgac
ttcttgccaccaactattacggccttttcagagcgctatcctgactataagaacttccgt
atttttgaatcaactactgttcaaatattagatgaagtggcgcaagggcatagtgagatt
gggattatctacctcaacaatcaaaataaaaaggggattatgcaacgggttgaaaaatta
ggtctggaggtcatcgaattgattcctttccatacccatatttatctccgtgagggtcat
cctttagcccagaaagaggaattagtcatggaggatttagcggatttaccaacggttcgt
ttcactcaagagaaagacgagtacctttattattcagagaactttgtcgataccagcgct
agctcacagatgtttaatgtgacagaccgtgccaccttgaatggtattttggagcggacg
gacgcctatgcgacaggttctggatttttagatagtgacagtgttaatggtattacagtt
attcgtctcaaggataacctagataaccgcatggtctatgttaaacgtgaagaagtggag
cttagtcaagctgggactctcttcgtagaagtcatgcaagaatattttgatcaaaagagg
aaatcatga

DBGET integrated database retrieval system