KEGG   Streptococcus pneumoniae 670-6B: SP670_1400Help
Entry
SP670_1400        CDS       T01308                                 

Gene name
lys
Definition
(GenBank) saccharopine dehydrogenase
  KO
K00290  
saccharopine dehydrogenase (NAD+, L-lysine forming) [EC:1.5.1.7]
Organism
snb  Streptococcus pneumoniae 670-6B
Pathway
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:snb00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SP670_1400 (lys)
   00310 Lysine degradation
    SP670_1400 (lys)
Enzymes [BR:snb01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.7  saccharopine dehydrogenase (NAD+, L-lysine-forming)
     SP670_1400 (lys)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
complement(1311941..1313200)
Genome map
AA seq 419 aa AA seqDB search
MSRLLVIGCGGVAQVAISKICQDSETFTEIMIASRTKSKCDDLKAKLEGKTSTKIETAAL
DADKVEEVIALIESYKPEAVLNVALPYQDLTIMDACLATGVHYIDTANYEAEDTEDPEWR
AIYEKRCKELGFTAYFDYSWQWAYQEKFKEAGLTALLGSGFDPGVTSVFSAYALKHYFDE
IHYIDILDCNGGDHGYPFATNFNPEINLREVSAPGSYWEDGKWVEVEAMSIKREYDFPQV
GQKDMYLLHHEEIESLAKNIPGVKRIRFFMTFGQSYLTHMKCLENVGLLRTDTINFNGQE
IVPIQFLKALLPDPASLGPRTVGKTNIGCIFTGVKDGVEKTIYIYNVCDHQECYAEVGSQ
AISYTTGVPAMIGTKLVMNGTWKQAGVYNLEELDPDPFMEALNEYGLPWVVVENPQMVD
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtttactagttattggttgtgggggcgttgcccaagttgctatttcaaagatt
tgtcaagatagcgaaacatttacagagattatgattgctagccgtaccaagtcaaaatgc
gatgacttgaaagcgaagctagaaggcaaaacaagtactaaaattgaaactgcagcactt
gatgctgacaaggttgaagaagtgattgccctgattgaaagctacaaaccagaagctgtt
ttgaatgtagctctgccttatcaagatttaaccattatggatgcttgtttggcaacaggt
gttcactatatcgatacagccaactacgaagcagaagacacagaagaccctgagtggcgt
gctatctacgaaaaacgttgtaaggaacttggttttacagcctactttgactactcatgg
cagtgggcttatcaagagaaattcaaagaagcaggcttgactgctcttcttggttctggt
tttgacccaggtgtaactagtgtcttttcagcttatgccctcaaacactattttgatgaa
atccattatatcgacattttagactgtaatggcggtgaccacggttatccatttgcaacc
aactttaatccagaaattaatctccgtgaggtttctgcgccaggttcttactgggaagat
gggaaatgggtcgaagtcgaagctatgtctatcaagcgtgagtatgatttccctcaagtt
ggacaaaaagatatgtatctccttcaccatgaagaaatcgaatcattggccaagaacatt
ccaggtgtcaaacgcattcgtttctttatgacttttggtcaatcttacttgacgcacatg
aaatgtcttgaaaatgttggactccttcgtacggataccattaactttaacggccaagaa
attgttccaattcaatttttgaaagccttgcttccagatcctgctagccttggcccacgt
acagtcggaaaaaccaatattggatgtatctttacaggtgtcaaagatggcgttgaaaag
actatctacatctacaatgtttgcgaccatcaagagtgctatgcagaagtcgggtcacaa
gcaatttcatacacgacaggcgttccagccatgattgggacaaaattagtcatgaacgga
acttggaaacaagctggagtgtataaccttgaggagttagatccagatccattcatggaa
gctttgaatgagtatggtttgccatgggttgtggttgaaaatccacaaatggtggactaa

DBGET integrated database retrieval system