KEGG   Streptococcus pneumoniae 670-6B: SP670_1409Help
Entry
SP670_1409        CDS       T01308                                 

Definition
(GenBank) bacitracin export ATP-binding protein BceA
  KO
K02003  putative ABC transport system ATP-binding protein
Organism
snb  Streptococcus pneumoniae 670-6B
Module
snb_M00258  Putative ABC transport system
Brite
Transporters [BR:snb02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Putative ABC transporter [MD:M00258]
    SP670_1409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 RsgA_GTPase AAA_29 AAA_16 SMC_N NACHT MMR_HSR1 AAA_30 AAA_22 IstB_IS21 Rad51 AAA_23 ATPase_2 FtsK_SpoIIIE ATP-synt_ab AAA_15 Dynamin_N AAA_28 RNA_helicase AAA_18 DEAD
Motif
Other DBs
NCBI-ProteinID: ADM91467
Position
complement(1320873..1321631)
Genome map
AA seq 252 aa AA seqDB search
MTLLDVKHVQKIYKTRFQGNQVEALKDIHFTVEKGDYVAIMGESGSGKSTLLNILAMLDK
PSRGQVYLNGTDTATIKNSQASSFRREKLGFVFQDFNLLDTLSVKDNILLPLVLSRRPIT
EMMKKLVVTAENLGINQLQEKYPYEISGGQKQRVAVARAIITEPEILLADEPTGALDSKS
SAALLDVFDEINERGQTILMVTHSTAAASRAKRVLFIKDGILYNQIYRGEKTERQMFQEI
SDTLTVMASEVN
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgacacttttagatgtaaaacacgttcaaaaaatttataaaacacgttttcagggcaac
caagtagaagccctcaaggatattcactttaccgtcgaaaagggtgactacgttgccatc
atgggtgagtctggttctggtaaatcaactcttctcaatattctagctatgctggataaa
ccaagtcgtggtcaggtttacttgaatggaactgacaccgcaaccattaaaaattcacag
gcctctagcttccgtcgtgaaaagttgggctttgtcttccaagactttaacttgctagat
actctatctgtaaaggacaatatcttgcttccgcttgtcttgtcaagaagacctattaca
gagatgatgaagaaattggtggtgacagctgagaatctgggaataaaccaattacaagag
aagtacccttacgagatttctggtggccagaaacagcgtgtagcagtagcacgcgccatc
atcactgaacctgaaattctccttgcggacgaaccgacaggagctcttgactccaagtca
tctgcagccttacttgatgtctttgatgaaatcaatgagcgcggccaaaccattctcatg
gtaacccactcaacagcagcagctagcagagctaaacgtgtactctttatcaaagacggc
attctttacaatcaaatctaccgtggagagaagacagaacgtcagatgttccaagaaatc
tctgataccttgactgtcatggcaagcgaggtgaattag

DBGET integrated database retrieval system