KEGG   Streptococcus pneumoniae 670-6B: SP670_1409Help
Entry
SP670_1409        CDS       T01308                                 

Definition
(GenBank) bacitracin export ATP-binding protein BceA
  KO
K02003  
putative ABC transport system ATP-binding protein
Organism
snb  Streptococcus pneumoniae 670-6B
Module
Putative ABC transport system
Brite
Transporters [BR:snb02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Putative ABC transporter [MD:M00258]
    SP670_1409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1320873..1321631)
Genome map
AA seq 252 aa AA seqDB search
MTLLDVKHVQKIYKTRFQGNQVEALKDIHFTVEKGDYVAIMGESGSGKSTLLNILAMLDK
PSRGQVYLNGTDTATIKNSQASSFRREKLGFVFQDFNLLDTLSVKDNILLPLVLSRRPIT
EMMKKLVVTAENLGINQLQEKYPYEISGGQKQRVAVARAIITEPEILLADEPTGALDSKS
SAALLDVFDEINERGQTILMVTHSTAAASRAKRVLFIKDGILYNQIYRGEKTERQMFQEI
SDTLTVMASEVN
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgacacttttagatgtaaaacacgttcaaaaaatttataaaacacgttttcagggcaac
caagtagaagccctcaaggatattcactttaccgtcgaaaagggtgactacgttgccatc
atgggtgagtctggttctggtaaatcaactcttctcaatattctagctatgctggataaa
ccaagtcgtggtcaggtttacttgaatggaactgacaccgcaaccattaaaaattcacag
gcctctagcttccgtcgtgaaaagttgggctttgtcttccaagactttaacttgctagat
actctatctgtaaaggacaatatcttgcttccgcttgtcttgtcaagaagacctattaca
gagatgatgaagaaattggtggtgacagctgagaatctgggaataaaccaattacaagag
aagtacccttacgagatttctggtggccagaaacagcgtgtagcagtagcacgcgccatc
atcactgaacctgaaattctccttgcggacgaaccgacaggagctcttgactccaagtca
tctgcagccttacttgatgtctttgatgaaatcaatgagcgcggccaaaccattctcatg
gtaacccactcaacagcagcagctagcagagctaaacgtgtactctttatcaaagacggc
attctttacaatcaaatctaccgtggagagaagacagaacgtcagatgttccaagaaatc
tctgataccttgactgtcatggcaagcgaggtgaattag

DBGET integrated database retrieval system