KEGG   Streptococcus pneumoniae 670-6B: SP670_1415Help
Entry
SP670_1415        CDS       T01308                                 

Definition
(GenBank) conserved hypothetical protein
Organism
snb  Streptococcus pneumoniae 670-6B
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
Position
1325779..1325910
Genome map
AA seq 43 aa AA seqDB search
MAVKFTKRDDLDKMFEEFAKLPDLKQVTFPDDKEKKVKAEKKN
NT seq 132 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaaaatttacaaaacgagacgacttggacaagatgtttgaagagtttgctaaa
ctccctgatttgaaacaagttactttccctgatgacaaagagaaaaaagtcaaagcagaa
aagaaaaactag

DBGET integrated database retrieval system