KEGG   Streptococcus pneumoniae 670-6B: SP670_1418Help
Entry
SP670_1418        CDS       T01308                                 

Definition
(GenBank) conserved hypothetical protein
Organism
snb  Streptococcus pneumoniae 670-6B
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1327758..1328474)
Genome map
AA seq 238 aa AA seqDB search
MKKYFISGLGSNAYHSKDFFQELDSQVYFLNPYEKHLRDETELKSWFKNEIVEEESICLI
GHSLGGDLARYFASEFEEVKKLILLDGGYLDLDKILPLDTELEETKNYIKSQIVSDLALL
ISKEKSEAKHWSENMEKAVRQSYHWNVEYNRYELAINYENIEAILRLRRKIQAFKREVGD
TLFISPRYPNGATWREEALKELPDYFNTIFLENFGHELYTQAPKEIASLMNEWLAYFL
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatattttattagcggtttgggaagcaatgcctatcatagcaaggattttttt
caagaactagattcgcaggtctattttctaaatccatatgaaaagcatcttcgagatgaa
acagaattgaaatcatggtttaaaaatgagattgtagaggaagaatctatctgtctgata
ggtcattctcttggaggagatttagctcgttatttcgcatcggaatttgaagaagtaaag
aaactgattcttttggatggtggctatctagatttagataagattttacctttggataca
gagttagaggaaactaaaaattatatcaaatctcaaattgtttcggacttagctcttctt
atttctaaagagaagtccgaagcaaagcattggtcagaaaatatggagaaagctgtaaga
cagtcctatcactggaatgttgagtataatagatatgagttggctataaattatgaaaat
atagaagcgatactccgcctacggagaaaaatacaagcttttaagagagaagtgggagat
accttgtttattagtcctcgctatcctaatggagctacatggagagaggaagccctaaaa
gaattgccagactattttaatactatttttttagaaaactttggccatgagctttatact
caagcacctaaagaaatcgctagtctaatgaatgagtggctcgcttattttctatga

DBGET integrated database retrieval system