KEGG   Streptococcus pneumoniae 670-6B: SP670_1426Help
Entry
SP670_1426        CDS       T01308                                 

Definition
(GenBank) DNA polymerase III subunit alpha
  KO
K02337  
DNA polymerase III subunit alpha [EC:2.7.7.7]
Organism
snb  Streptococcus pneumoniae 670-6B
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:snb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SP670_1426
   00240 Pyrimidine metabolism
    SP670_1426
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SP670_1426
   03430 Mismatch repair
    SP670_1426
   03440 Homologous recombination
    SP670_1426
Enzymes [BR:snb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SP670_1426
DNA replication proteins [BR:snb03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     SP670_1426
DNA repair and recombination proteins [BR:snb03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     SP670_1426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1334720..1337821)
Genome map
AA seq 1033 aa AA seqDB search
MIAQLDTKTVYSFMESVISIEKYVRAAKEYGYTHLAMMDIDNLYGAFDFLEITKKYGIHP
LLGLEMTVFVDDQGVNLRFLALSSVGYQQLMKLSTAKMQGEKTWSVLSQYLEDIAVIVPY
FDRVESLELGCDYYIGVYPETLASEFHHPILPLYRVNAFESRDREVLQVLTAIKENLPLR
EVPLRSRQDVFISASSLEKLFQERFPQALDNLEKLISGISYDLDTSLKLPRFNPARPAVE
ELRERAELGLVQKGLTSKEYQDRLDQELSVIHDMGFDDYFLVVWDLLRFGRSNGYYMGMG
RGSAVGSLVSYALDITGIDPVEKNLIFERFLNRERYTMPDIDIDIPDIYRPDFIRYVGNK
YGSKHAAQIVTFSTFGAKQALRDVLKRFGVPEYELSAITKKISFRDNLKSAYEGNLQFRQ
QINSKLEYQKAFEIACKIEGYPRQTSVHAAGVVISDQDLTNYIPLKYGDEIPLTQYDAHG
VEASGLLKMDFLGLRNLTFVQKMQELLAEIEGIHLKIEEIDLEDKETLDLFASGNTKGIF
QFEQPGAIRLLKRVQPVCFEDVVATTSLNRPGASDYINNFVARKHGQEEVTVLDPVLEDI
LAPTYGIMLYQEQVMQVAQRFAGFSLGKADILRRAMGKKDASAMHEMRASFIQGSLEAGH
TVEKAEQVFDVMEKFAGYGFNRSHAYAYSALAFQLAYFKTHYPAIFYQIMLNSANSDYLI
DALEAGFEVAPLSINTIPYHDKIANKAIYLGLKSIKGVSNDLALWIIEHRPYSNIEDFIA
KLPENYLKLPLLEPLVKVGLFDSFEKNRQKVFNNLANLFEFVKELGSLFGDAIYSWQESE
DWTEQEKFYMEQELLGIGVSKHPLQAIASKAIYPITPIGNLSENSYAIILVEVQKIKVIR
TKKGENMAFLQADDSKKKLDVTLFSDLYRQVGQEIKEGAFYYVKGKIQSRDGRLQMIAQE
IREAVAERFWIQVKNHESDQEISRILEQFKGPIPVIIRYEEEQKTIVSPHHFVAKSNELE
EKLNEIVMKTIYR
NT seq 3102 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgcacaactagatacaaaaacagtctatagttttatggaaagcgtcatttcgatc
gaaaagtatgtgagagcagctaaagaatacggctacactcatttggctatgatggatatt
gacaatctttatggcgctttcgactttctagagattacaaaaaaatacggcattcatcct
ttgctagggcttgaaatgacagtgtttgtagatgatcagggagtaaatttgcgcttttta
gctctatctagtgtgggctatcagcagttgatgaagctttcgacagccaagatgcagggg
gagaaaacttggtcagtcctgtcccagtacctggaggatatcgcggtcattgtgccttat
tttgatagagttgagtcgttagaactaggctgtgattactatataggggtttatccagaa
acactagcaagcgaatttcatcatcctatcttacctctttatcgggtcaacgcttttgaa
agcagggatagagaagttcttcaagttttaacagcgattaaagaaaatctaccgctcaga
gaagttcccttgcgttcgagacaagatgtctttatatcagcaagttctttagagaaacta
ttccaagagcgttttccgcaagctttggacaatttagaaaagcttatttcaggcatttct
tacgacttggatactagtctgaaactgcctcgttttaatccagctagaccagcagtagag
gagttgagagagcgtgctgaactggggcttgttcagaaggggttgactagtaaagaatat
caagatagactagaccaagaattgtctgttattcatgatatgggctttgatgattatttc
ttggttgtttgggatttgttgcgttttggacgatcgaatggctattatatgggaatggga
aggggttctgcagtaggcagtttggtttcttatgccttagacatcacggggattgaccca
gtagagaaaaatctgatttttgaacgctttcttaatcgtgaacgctataccatgcctgat
attgatattgatatcccagatatttatcgtccagattttatcagatatgttggtaataaa
tatggtagtaaacatgcggcacaaatcgttactttttcaacctttggagccaagcaagct
cttcgagatgtcttgaaacgctttggtgtgccagagtatgaattatctgcaattactaag
aaaatcagttttcgtgacaatcttaagtcggcctatgagggcaatctccagtttcgtcag
caaatcaatagtaagttagaataccaaaaagcttttgagattgcttgcaagatagagggc
tatccaaggcaaacctctgtccatgcggctggtgttgtaattagtgaccaagatttaacc
aactacattcctctaaagtatggtgatgaaattccactgactcagtatgatgctcatgga
gttgaggctagcggacttttgaagatggactttctgggactacgaaatttgacctttgtc
cagaagatgcaagagttgcttgctgaaatagaaggtattcaccttaaaattgaagaaata
gatttggaagacaaagaaacgttagatttatttgcctctggaaatacaaaaggtatcttt
caatttgagcaacctggtgctattcgcttgctcaaacgtgttcaaccagtctgttttgaa
gatgtcgtagcaactacttctctaaatcgaccgggtgctagtgactatatcaataatttt
gtggcaagaaagcatgggcaggaagaagtgactgttctggatccagtactggaggatatt
ttggctccaacctacggcataatgctctatcaggagcaggttatgcaggttgcccagcga
tttgccggatttagtcttgggaaagccgatattttgcgtcgggctatggggaaaaaggat
gcctctgccatgcatgagatgagggcttcctttattcaaggttcattagaagctggtcat
actgtggaaaaagcagagcaggtctttgatgttatggagaagtttgcaggctatggtttt
aacaggtcacacgcctatgcctactcagcattggccttccagttggcttattttaaaaca
cattatccagccatattttatcagatcatgttgaattctgccaacagtgattacttaata
gatgcacttgaagcaggttttgaagtggcgcctctgtccatcaacacgattccctatcac
gataaaattgccaacaaggccatctatctaggtttgaaatccattaaaggagtcagtaat
gatttagctctctggattattgaacatagaccttattctaatattgaagattttatagct
aaattacctgagaattatctgaaacttcctctgctagaacctttggtaaaagttggtctt
ttcgattcatttgaaaaaaatcgtcaaaaagtatttaataacttagctaatctatttgaa
tttgtgaaagagttgggaagtttgtttggagatgctatttatagttggcaggaatcggaa
gattggacggaacaagaaaaattttatatggaacaagagcttttagggataggtgtcagc
aaacatccactacaagctattgcaagtaaggctatttacccgattaccccaatcggaaat
ttgtcagaaaatagctatgctattattttggttgaagttcagaaaataaaagtgattcgt
accaaaaagggtgaaaatatggccttcttacaggcagatgatagtaagaaaaaattggat
gtcactctcttttcagacttatatcgtcaggttggacaggaaataaaagagggagccttc
tactatgtaaaaggaaaaatacaatcacgtgatggccgtctgcaaatgattgcacaagaa
ataagagaagcagttgctgaacgcttttggatacaggtgaaaaatcatgaatcggatcaa
gaaatttcacgtattttagaacaatttaaaggcccaatcccagtcatcatccggtatgaa
gaggaacagaaaaccatcgtttctccccatcattttgtagctaaatccaatgaattagag
gagaaattgaatgaaatcgttatgaaaacgatttatcgctaa

DBGET integrated database retrieval system