KEGG   Streptococcus pneumoniae 670-6B: SP670_1429Help
Entry
SP670_1429        CDS       T01308                                 

Definition
(GenBank) type I restriction-modification system R subunit
  KO
K01153  
type I restriction enzyme, R subunit [EC:3.1.21.3]
Organism
snb  Streptococcus pneumoniae 670-6B
Brite
Enzymes [BR:snb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.3  type I site-specific deoxyribonuclease
     SP670_1429
Prokaryotic defense system [BR:snb02048]
 Restriction and modification system (R-M system)
  Type I R-M system
   SP670_1429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1341434..1344784)
Genome map
AA seq 1116 aa AA seqDB search
MGNFSFLLKNDEYESFSKPCIEAENMIATSTVATAFMARRALEQAVHWIYSHDSYLEAPY
RATLSSLVWDDDFRDIVDSELHKQIVLLIRWGNHAAHGGEIKEREAILALHHLYQFVNFI
DYCYSNEFVERYFDEKCLPLSANIKYRETPQSMIKLQDSLPELPDFHEQMAAQSVEVQET
YTEKRETAAQRQDVPFHIEQLSEAETRKLFIDIDLRLAGWIFEENCRVEIAVDGLKHGSG
IGYCDYVLYGKNGKILAIVEAKKASVNPEVGEVQVKEYAEALEKHIGYQPICFITNGLKH
YILDGPNRRQIAGFYSQEELQLVMDRRHLQKPLEDISSKIRDDISGRHYQKHAIASVCEA
FSNHRRQALLVMATGAGKTRTAVSLVDILSRHNWVKNVLFLADRTSLVKQAYDSFRKLLP
DLSVCNFLEDKEGAQSSRMVFSTYPTMIGAISGQEEVNQRPFTVGHFDLIIIDESHRSIY
QKYKSIFDYFDARIVGLTATPRQDLDKNTYGFFNLENGVPTYAYDLEEAVKDGYLVAYHS
IETKLKLPTDGLHYDDLSEEEKEHFDSKFEDDSCEKDIDGSVFNSFVFNKSTVEIVLNEL
MTRGIQTASGDEIGKTIIFAKNHDHAEYIRGIFNNRYPEKGSDYAQVIDYSIKHYQTLID
DFKIKEKYPQIAISVDMLDTGIDVPEVVNLVFFKKVRSKTKFWQMIGRGTRLCKDLFGPE
QDKENFLVFDYGDNFDYFRADPRDGEGRHIVSLTQRLFNIKVDLIRELQGLQYQEDQFAR
AYRQQLVSELQGRIESLNELDFRVRMVLDTVYSYRKLESWQNLTAVTSETIQKNLSPLLF
DEDKEDEMARRFDLWLLHIQLGQLTAKSSTVHISQVMKTARALSAIGNIPQVFEQAEIIR
KVQEPEFWKEVNLSDLEKIRLAIRDLLQFLDKTDRKPYYVNFEDRILSTVHETTAFLQVN
DLRSYNEKVEHYLKTHLDEESISKLYHNKKLTSDDMLALEKLLWEKLGSKADYQSHYENK
AIPRLVREIIGLDRESANRIFSKFLSDENLNARQISFVKLIVDYIVENGFLETKVLTQEP
FKSYGSVQLLFQHQLPVLRNIVQIIELINNRAGEAA
NT seq 3351 nt NT seq  +upstreamnt  +downstreamnt
atgggaaattttagctttcttttaaaaaatgacgaatatgaatctttttcaaaaccttgc
attgaagctgaaaatatgattgctacatcaactgtggctactgcctttatggcgcgtcgt
gctttggagcaggctgtccattggatatatagtcacgattcatatttagaagctccctat
cgtgctactctatcttctttagtatgggatgatgattttagggatatcgtagattctgaa
ctccacaagcagatagttctgttgattcggtggggaaaccatgctgctcatggtggtgaa
attaaggaacgagaagcgattttagctttacatcatttgtatcagtttgttaattttatc
gattattgttacagcaatgaatttgtggagcgttattttgatgagaagtgcttaccactt
tcagcaaacatcaaataccgagaaactccacaatctatgataaagttacaagacagttta
ccagaactgcctgattttcatgaacagatggctgctcagtccgtagaagttcaagagact
tatactgaaaaacgtgagactgcagcgcaacggcaagatgtgcctttccatattgaacaa
ttatctgaggcagagacaagaaagctctttattgatatcgatctccgtttagcaggatgg
atatttgaagaaaactgtcgtgttgagatagccgttgatggtctcaagcacggttcagga
attggttactgtgactacgtactttatggtaaaaatgggaaaattttagcgattgtggag
gctaaaaaagcctctgtcaatccagaagtaggggaagtacaggtcaaagaatatgctgaa
gctttggagaaacatatcggctatcagccaatttgctttattacaaatgggttgaagcac
tatatacttgatggtccgaaccgccgccagattgcaggcttttactctcaagaagaattg
caattagtgatggatagacgtcatcttcaaaaaccgcttgaggatatttctagtaaaatt
agggacgatatttccgggcgtcactaccaaaaacatgccattgcaagcgtttgtgaagct
ttctctaatcatcgtagacaggcacttttggttatggcaactggggcggggaaaactcgt
acagcagtttctctagttgatatcttatcacgtcataactgggtaaaaaacgttctcttc
ttagccgatagaacttccttggttaagcaagcctatgattcgtttagaaaattactccca
gatctttccgtttgtaacttcttagaagataaagaaggagctcaatcaagtcgtatggtc
ttttcaacttatccgaccatgattggagcgattagtggtcaagaagaagtaaatcaacgc
ccttttactgttgggcattttgaccttatcataattgacgaatctcaccgttctatttat
cagaaatacaagtccatttttgattattttgatgcaagaattgtaggcttaacagctact
ccgcgtcaagatttagataaaaacacctatggattctttaatttggagaatggggttcca
acatatgcatatgatttggaagaggctgttaaagacggatatttagtagcctatcattct
atcgaaaccaaactgaaactacctacggatggtctacattatgatgatttgtccgaagaa
gaaaaggaacattttgatagcaaatttgaagacgatagctgtgaaaaagatattgatggg
agtgtatttaattcctttgttttcaataaaagtacagtagaaattgttttaaatgaactc
atgacaagaggaattcagacagcctcgggtgatgaaattggtaaaactattatttttgct
aaaaatcatgatcatgcggaatatatcagaggtatttttaacaaccgctatcctgaaaaa
gggagcgactatgctcaggtgattgattatagtattaagcattatcagaccttgattgat
gattttaaaattaaggagaagtatcctcaaattgcgatttctgtcgatatgttagataca
ggtattgatgtaccagaggttgttaatttagtcttcttcaagaaagtacgctctaaaact
aagttttggcagatgattggtcgaggaacccgtctatgtaaagatttatttggacctgag
caggataaggaaaacttcttggtatttgattatggggataattttgattattttcgtgca
gatccaagagatggagagggtcgtcacattgtttcgttgactcagcgtttatttaatatc
aaagtggacttgattcgagaacttcagggactccaataccaagaagatcagtttgcgaga
gcataccgtcagcagcttgtctcggaacttcaaggtcgtatagagagcttaaatgagttg
gacttcagggttcgtatggttttagatacagtttatagctataggaaattggaaagttgg
cagaatctaactgctgttacaagtgaaaccattcaaaaaaatctctctccgcttttattt
gatgaagataaagaagatgagatggcgaggagatttgatttgtggttgcttcatattcag
ttggggcaactgacagctaaatcttccactgttcatatttcccaagtgatgaagacggct
agagctctttctgctattggcaatatcccgcaggtttttgagcaggctgaaattatcagg
aaagtacaggagcctgaattttggaaagaagttaacttgtctgatttggaaaaaattcgt
cttgctattcgagatttattacagtttttggataaaacagaccgtaaaccctactatgtt
aactttgaagatcgtatactctccactgttcacgagaccacagcatttttgcaggtcaac
gatcttcggtcttacaatgaaaaagttgagcattatttgaaaactcatctggatgaggag
tccatttctaagctataccataataaaaagttgacatctgatgatatgcttgcacttgaa
aaattgctctgggaaaaattaggtagtaaagcagactaccaaagtcattatgaaaataag
gcaattccgagattggttcgtgagattattggcttagatagagagtctgccaatcgtatt
ttttctaaatttttgtcggatgagaatcttaatgccaggcagatttcatttgtaaaattg
attgtagactacattgtagaaaatggttttttagagacgaaagtgttaacgcaagagccg
tttaaatcttatggttctgttcaactactcttccaacaccaactaccagtacttcgtaat
attgttcaaatcattgaacttatcaataatcgagctggagaagcggcttaa

DBGET integrated database retrieval system