KEGG   Streptococcus pneumoniae 670-6B: SP670_1449Help
Entry
SP670_1449        CDS       T01308                                 

Gene name
pfkB
Definition
1-phosphofructokinase (EC:2.7.1.56)
Orthology
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
snb  Streptococcus pneumoniae 670-6B
Pathway
Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:snb00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SP670_1449 (pfkB)
Enzymes [BR:snb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.56  1-phosphofructokinase
     SP670_1449 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1360492..1361403)
Genome map
AA seq 303 aa AA seqDB search
MIYTVTLNPSIDYIVRLDQVKVGSVNRMDSDDKFAGGKGINVSRVLKRLNIPNTATGFIG
GFTGKFITDTLAEEEIETRFVQVAEDTRINVKIKADQETEINGTGPTVESVQLEELKAIL
SSLTAEDTVVFAGSSAKNLGNVIYKDLISLTRQTGAQVVCDFEGQTLIDSLDYQPLLVKP
NNHELGAIFGVKLESLDEIEKYARELLAKGAQNVIISMAGDGALLVTSEGAYFAKPIKGT
VKNSVGAGDSMVAGFTGEFVKSKDVVEAFKWGVACGTATTFSDDLATAEFIKETYGKVEV
EKR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgatttatacagtcacactcaatccatccattgactatatcgttcgtttggaccaagtc
aaagttggtagtgtaaatcgtatggacagtgatgataagtttgctggtgggaaaggaatc
aatgtcagccgtgtcttgaaacgtttgaatataccaaatacagcgacgggatttatcggt
ggctttactggtaaatttatcacagatactttagcagaggaagaaatcgagacacgtttt
gtccaggtggcagaagatactcgtatcaatgttaaaatcaaagcagaccaagaaacagaa
atcaacggaacgggtccaactgttgaatcggttcagctagaagaattgaaagctatttta
tctagtctgacagcagaagatacagttgtctttgcaggttcaagtgctaaaaatctaggc
aatgttatctataaggatttgatttccttgacgcgccagactggtgcgcaagtggtctgt
gactttgaaggacagaccttaattgatagtttggactaccagcctcttcttgtaaaacca
aacaatcatgaacttggagcgatttttggggttaaactcgaaagtttagatgaaattgag
aaatacgctcgtgagttactggctaagggtgctcaaaatgttattatctctatggctggt
gatggtgcccttcttgtcacatctgagggagcttacttcgctaaaccaatcaaaggaaca
gtcaaaaattcagttggagctggtgattctatggttgctggattcacaggtgaatttgtc
aaatcaaaagacgtagtagaagccttcaaatggggagtggcttgcggaacggcaactacc
ttctcagatgacttggcaacggcggaatttattaaagaaacatatggaaaagttgaggta
gaaaaaagatga

DBGET integrated database retrieval system