KEGG   Streptococcus pneumoniae 670-6B: SP670_1659Help
Entry
SP670_1659        CDS       T01308                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
snb  Streptococcus pneumoniae 670-6B
Pathway
snb00010  Glycolysis / Gluconeogenesis
snb00051  Fructose and mannose metabolism
snb00562  Inositol phosphate metabolism
snb01100  Metabolic pathways
snb01110  Biosynthesis of secondary metabolites
snb01120  Microbial metabolism in diverse environments
snb01130  Biosynthesis of antibiotics
snb01200  Carbon metabolism
snb01230  Biosynthesis of amino acids
Module
snb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
snb_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:snb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SP670_1659 (tpiA)
   00051 Fructose and mannose metabolism
    SP670_1659 (tpiA)
   00562 Inositol phosphate metabolism
    SP670_1659 (tpiA)
Enzymes [BR:snb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SP670_1659 (tpiA)
Exosome [BR:snb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SP670_1659 (tpiA)
  Exosomal proteins of bladder cancer cells
   SP670_1659 (tpiA)
  Exosomal proteins of melanoma cells
   SP670_1659 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADM91715
Structure
PDB: 

Jmol
Position
complement(1549444..1550202)
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFVEAVASKLPSSDLVEAGIAAPALDLTTVLAVAKGSNL
KVAAQNCYFENAGAFTGETSPQVLKEIGTDYVVIGHSERRDYFHETDEDINKKAKAIFAN
GMLPIICCGESLETYEAGKAAEFVGAQVSAALAGLTAEQVAASVIAYEPIWAIGTGKSAS
QDDAQKMCKVVRDVVAADFGQEVADKVRVQYGGSVKPENVASYMACPDVDGALVGGASLE
AESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttatcgctggtaactggaaaatgaacaaaaatccagaagaagct
aaagcattcgttgaagcagttgcatcaaaacttccttcatcagatcttgttgaagcaggt
atcgctgctccagctcttgatttgacaactgttcttgctgttgcaaaaggctcaaacctt
aaagttgctgctcaaaactgctactttgaaaatgcaggtgctttcactggtgaaactagc
ccacaagttttgaaagaaatcggtactgactacgttgttatcggtcactcagaacgccgt
gactacttccatgaaactgatgaagatatcaacaaaaaagcaaaagcaatctttgcgaac
ggtatgcttccaatcatctgttgtggtgaatcacttgaaacttacgaagctggtaaagct
gctgaattcgtaggtgctcaagtatctgctgcattggctggattgactgctgaacaagtt
gctgcctcagttatcgcttatgagccaatctgggctatcggtactggtaaatcagcttca
caagacgatgcacaaaaaatgtgtaaagttgttcgtgacgttgtagctgctgactttggt
caagaagtcgcagacaaagttcgtgttcaatacggtggttctgttaaacctgaaaatgtt
gcttcatacatggcttgcccagacgttgacggtgcccttgtaggtggtgcgtcacttgaa
gctgaaagcttcttggctttgcttgactttgtaaaataa

DBGET integrated database retrieval system