KEGG   Streptococcus pneumoniae 670-6B: SP670_2118Help
Entry
SP670_2118        CDS       T01308                                 

Definition
PTS system ascorbate-specific transporter subunit EIIC
Orthology
K03475  
PTS system, ascorbate-specific IIC component
Organism
snb  Streptococcus pneumoniae 670-6B
Pathway
Ascorbate and aldarate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Phosphotransferase system (PTS)
Module
PTS system, ascorbate-specific II component
Brite
KEGG Orthology (KO) [BR:snb00001]
 Metabolism
  Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    SP670_2118
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    SP670_2118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1980473..1981930)
Genome map
AA seq 485 aa AA seqDB search
MEVVSSVLNWFSSNILQNPAFFVGLLVLIGYALLKKPAHDVFSGFVKATVGYMLLNVGAG
GLVTTFRPILAALNYKFQIGAAVIDPYFGLAAANNKIVAEFPDFVGTATTALLIGFGINI
LLVALRKITKVRTLFITGHIMVQQAATVSLMVLFLVPQLRNAYGTAAIGIICGLYWAVSS
NMTVEATQRLTGGGGFAIGHQQQFAIWFVDKVAGRFGKKEESLDNLKLPKFLSIFHDTVV
ASATLMLVFFGAILLILGPDIMSNKEVITSGTLFNPAKQDFFMYIIQTAFTFSVYLFVLM
QGVRMFVSELTNAFQGISNKLLPGSFPAVDVAASYGFGSPNAVLSGFTFGLIGQLITIVL
LIVFKNPILIITGFVPVFFDNAAIAVYADKRGGWKAAVILSFISGVLQVALGALCVALLD
LASYGGYHGNIDFEFPWLGFGYIFKYLGIVGYVLVCLFLLVIPQLQFAKAKDKEKYYNGE
VQEEA
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggaagtcgtttcaagtgttctaaattggttttctagcaatattttgcagaatcccgca
tttttcgtaggtttattggtgttgataggatatgcacttttgaaaaaacctgcccatgac
gttttttcagggtttgttaaagcaacagtagggtatatgttgcttaacgtgggtgctggt
ggtttggttacaacctttcgtccaatcttagcagctcttaactacaaattccaaattggt
gcagcggttatcgacccttactttggacttgctgcagcaaacaacaaaattgtagcagag
tttccagattttgttggaactgcaactacagctctattgattggttttggaataaatatc
ttgctcgtagctcttcgaaagattacgaaggtaagaaccctctttattactggtcacatc
atggtacaacaagctgcaacagtatctcttatggttctattcttagtaccacaattgcgc
aatgcttacggtacagcagcgattggtatcatctgtggactttactgggcagttagttca
aatatgactgttgaggcaactcaacgcttgactggtggtggcggatttgcgattggtcac
caacagcaatttgcaatctggtttgtagataaagtagcaggacgctttggtaagaaagaa
gaaagtttagacaatcttaaattacctaagttcctctcaatcttccacgatacagttgtt
gcatctgctaccttgatgctcgtattcttcggagccattcttttaatcttgggtccagac
attatgtctaataaagaagtcatcacttcaggaactctattcaatcctgctaaacaagat
ttctttatgtacattatccaaacagcctttaccttctcagtttacttgttcgttttgatg
caaggtgtccgaatgttcgtatctgagttgacaaacgccttccaaggtatttcaaacaaa
ttgttgccaggttcattcccagcggttgacgttgcagcttcttatggatttggttctcca
aatgctgtcttgtcaggatttacctttggtttgattggtcaattgattacaattgttttg
ctcatcgtctttaaaaatccgattcttattattacaggatttgtaccagtgttctttgac
aatgcagccattgcggtctacgctgataaacgcggcggatggaaagcggctgttatcctt
tcctttatatcaggtgtccttcaagttgctctaggagctctttgtgtggcccttctcgat
ttggcatcttatggtggctaccatggaaatatcgactttgaattcccatggcttggattt
ggatatatcttcaaataccttggtattgttggttatgtacttgtgtgtctcttcttgctt
gttattcctcaacttcaatttgccaaagcaaaagataaagagaaatattacaacggtgaa
gttcaagaagaagcttag

DBGET integrated database retrieval system