KEGG   Streptococcus pneumoniae 670-6B: SP670_2206Help
Entry
SP670_2206        CDS       T01308                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
snb  Streptococcus pneumoniae 670-6B
Pathway
snb00260  Glycine, serine and threonine metabolism
snb00750  Vitamin B6 metabolism
snb01100  Metabolic pathways
snb01110  Biosynthesis of secondary metabolites
snb01120  Microbial metabolism in diverse environments
snb01230  Biosynthesis of amino acids
Module
snb_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:snb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SP670_2206 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SP670_2206 (thrC)
Enzymes [BR:snb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SP670_2206 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP DUF4252
Motif
Other DBs
NCBI-ProteinID: ADM92258
Position
complement(2044788..2046272)
Genome map
AA seq 494 aa AA seqDB search
MTLVYQSTRDANNTVTASQAILQGLATDGGLFTPDTYPKVDLNFDKLKDASYQEVAKLVL
SAFLDDFTVEELDYCINNAYDSKFDTPAIAPLVKLDGQYNLELFHGSTIAFKDMALSILP
YFMTTAAKKHGLENKIVILTATSGDTGKAAMAGFANVPGTEIIVFYPKDGVSKIQELQMT
TQTGDNTHVIAIDGNFDDAQTNVKHMFNDVALREKLTTNKLQFSSANSMNIGRLVPQIVY
YVYAYAQLVKTGEIVAGEKVNFTVPTGNFGNILAAFYAKQIGLPVGKLICASNDNNVLTD
FFKTRVYDKKREFKVTTSPSMDILVSSNLERLIFHLLGNNAEKTTELMNALNTQGQYKLT
DFDAEILDLFAAEYATEEETAAEIKRVCELDSYIEDPHTAVASAVYKKYQSATGDVTKTV
IASTASPYKFPVVAVEAVTGKAGLTDFEALAQLHEISGVAVPPAVDGLEIAPIRHKTTVA
AADMQAAVEAYLGL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacattagtttatcaatcaacgcgtgatgccaacaatacagtaactgccagccaagca
attttgcaaggtttggcgacggacggcggtttgtttacaccggatacttatccaaaggta
gatttgaactttgacaaattgaaagatgcttcttaccaggaagttgctaagctagttttg
tcagcatttttagatgactttacagttgaggagttggactactgtatcaacaatgcctac
gatagcaaatttgatactccagctattgcaccattagtgaaattagatgggcaatacaat
ttggaacttttccatggttcaacgattgcctttaaggatatggccttgtctattttgcca
tactttatgacgactgctgctaagaaacatggtttggagaacaagattgttatcttgaca
gcgacatctggtgacacggggaaagctgctatggcggggtttgcgaatgtgcctggtact
gagattatcgtcttttatccaaaggatggtgtcagcaagattcaagagttacaaatgacc
actcagactggcgacaatactcatgttattgctattgatggtaactttgacgatgcgcaa
acaaatgtgaagcacatgtttaacgacgtggctcttcgtgaaaaattgactaccaacaag
ttgcaattttcatcagctaactctatgaacattggtcgtctggtgccacaaattgtttat
tatgtttatgcttacgctcaattggttaagactggtgaaattgtagctggtgaaaaggtt
aacttcacagtaccaacaggaaactttggaaatatcttggctgccttttatgccaaacaa
attggtttgccagttggtaaattaatctgtgcttcaaatgacaacaatgttttgacagac
ttctttaaaacacgtgtctatgacaaaaaacgtgagtttaaggtaacaaccagcccatct
atggatatcttggtatcttcaaacttggagcgcttgattttccatcttttgggaaataat
gctgaaaagacaactgaacttatgaatgccttgaacacgcaaggacaatataagttgaca
gactttgatgcagagattttggacctctttgcagctgaatatgcgactgaggaagaaacg
gcagcagagatcaagcgtgtttgtgagttagattcttatatcgaggaccctcatacagct
gttgcttcagcagtttataaaaaataccaatcggccactggagatgtaactaagacagtg
attgcttcaacagctagtccatacaagttcccagtagttgcagtagaagctgtaactgga
aaagcaggtttaacagactttgaagccttggctcaattacatgaaatctcaggcgttgca
gtgccaccagcagttgatgggcttgaaatagctccaattcgtcacaagacaacagtggca
gctgctgacatgcaagcagcggttgaggcttatttaggactttaa

DBGET integrated database retrieval system