KEGG   Streptococcus pneumoniae 670-6B: SP670_2210Help
Entry
SP670_2210        CDS       T01308                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
snb  Streptococcus pneumoniae 670-6B
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:snb00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2054535..2055995)
Genome map
AA seq 486 aa AA seqDB search
MSKDIRVRYAPSPTGLLHIGNARTALFNYLYARHHGGTFLIRIEDTDRKRHVEDGERSQL
ENLRWLGMDWDESPESHENYRQSERLDLYQKYIDQLLAEGKAYKSYVTEEELAAERERQE
VAGETPRYINEYLGMSEEEKAAYIAEREAAGIIPTVRLAVNESGIYKWHDMVKGDIEFEG
GNIGGDWIIQKKDGYPTYNFAVAIDDHDMQISHVIRGDDHIANTPKQLMVYEALGWEAPE
FGHMTLIINSETGKKLSKRDTNTLQFIEDYRKKGYLPEAVFNFIALLGWNPGGEDEIFSR
EELIKLFDENRLSKSPAAFDQKKLDWMSNDYIKNADLETIFEMAKPFLEEAGRLTDKAEK
LVELYKPQMKSVDEIIPLTDLFFSDFPELTEAEREVMTGETVPTVLEAFKAKLEAMTDDK
FVTENIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHGPELPDTIFLLGREKSIQHIENM
LKEISK
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagatatccgcgtacgttacgcaccaagtccaacaggactactacacatcgga
aatgctcgtacagcattgtttaattacttgtatgcgcgccatcatggtggaacatttctc
atccgtatcgaagatactgaccgtaaacgccatgtcgaggatggtgaacgttcacaactt
gaaaaccttcgctggttaggcatggattgggatgaaagtccagaatcacatgagaattat
cgccagtctgagcgtttggacttgtatcaaaaatacattgaccaactattagctgaagga
aaagcctataaatcttacgttacagaagaagagttggcagctgaacgcgaacgccaagaa
gtagctggcgaaacaccacgctacatcaatgaataccttggtatgagtgaagaagaaaaa
gcagcttacattgcagaacgtgaagcagcagggatcatcccaactgttcgtttggctgtc
aatgagtcaggtatctacaagtggcatgatatggtcaaaggcgatatcgaatttgaaggt
ggcaatatcggtggtgactggattatccaaaagaaagacggttacccaacttacaacttt
gccgttgccatcgatgaccatgatatgcaaatctctcatgttatccgtggagacgaccat
attgctaacacaccaaaacagctcatggtttatgaagcacttggttgggaagctccagag
tttggtcacatgaccttgattatcaactctgagactggtaagaagttatctaaacgtgat
actaatacacttcaatttatcgaagattaccgaaagaaaggttaccttccagaagcagtc
tttaactttattgctcttcttggttggaacccaggtggtgaagatgagattttctctcgt
gaagaactcattaaactttttgatgaaaaccgcctcagcaagtcaccagcagcctttgat
cagaaaaaactagactggatgagcaatgattatatcaagaatgcagaccttgaaaccatc
tttgaaatggcaaaaccattcttagaggaagcaggccgtttgactgacaaggctgaaaaa
ttagttgagctctataaaccacaaatgaaatcagtagatgagattatcccattgacagat
cttttcttctcagatttcccagaattgacagaagcagagcgcgaagtcatgacgggtgaa
acagttccaacagttcttgaagcattcaaagcaaaacttgaagcgatgacagatgataaa
tttgtgacagaaaatatcttcccacaaattaaagcagttcaaaaagaaacaggtattaaa
gggaaaaatcttttcatgcctattcgtatcgcagtttcaggcgaaatgcatgggccagaa
ttaccagatacaattttcttgcttggacgtgaaaaatcaattcagcatatcgaaaacatg
ctaaaagaaatctctaaataa

DBGET integrated database retrieval system