KEGG   Streptococcus pneumoniae 670-6B: SP670_2304Help
Entry
SP670_2304        CDS       T01308                                 

Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
snb  Streptococcus pneumoniae 670-6B
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:snb00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SP670_2304
Enzymes [BR:snb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     SP670_2304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2152261..2152989)
Genome map
AA seq 242 aa AA seqDB search
MSQDEKLIREQICDVCHKMWQLGWVAANDGNVSVRLDEDTILATPTGISKSFITPEKLVK
LNLKGEILEAEGDYCPSSEIKMHIRCYEEREDVRSVVHAHPPIATGFALAHIPLDTYSLI
ESAIVVGAIPITPFGVPSTMEVPEAITPYLPDHDVMLLENHGALTVGSDVITAYYRMETL
ELVAKTTFHGRMLLSTKGIEEQEIARPTLERLFSMRENYKVTGRHPGYRKYNGDGSIKET
KK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaagatgaaaaattaattcgtgaacagatttgtgatgtttgtcataagatgtgg
caacttggttgggttgctgctaacgatgggaatgtatctgttcgattagatgaggatacc
attcttgcaacacctactggtatcagcaaaagttttattacaccagaaaagctggtgaag
ttaaatcttaaaggagagattttagaagcagaaggtgattactgtccttctagtgaaatt
aaaatgcacattcggtgctacgaagaacgtgaggatgttcgttcagttgttcacgcgcat
ccaccgattgcaacaggatttgctcttgcacacattcctttagatacttattcactaatt
gagagcgcgattgtggttggggcaattcctattaccccatttggagtaccgtctacaatg
gaagtgccagaagcaattacaccttatctgcccgatcatgatgtcatgctattagaaaat
catggagctctgactgtcggaagcgatgtcattacagcatactaccgtatggaaacttta
gaattagtcgcaaagacaaccttccacggaagaatgttactttctacaaagggcattgag
gagcaagaaattgctcgtccgactttagaacgtctattctcaatgcgagaaaattataag
gttacaggtcgtcacccaggctaccgtaaatataatggcgatggtagtataaaagaaaca
aaaaaataa

DBGET integrated database retrieval system