KEGG   Streptococcus pneumoniae 670-6B: SP670_2306Help
Entry
SP670_2306        CDS       T01308                                 

Definition
alpha-galactosidase AgaN
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
snb  Streptococcus pneumoniae 670-6B
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:snb00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:snb00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:snb00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2156035..2158248)
Genome map
AA seq 737 aa AA seqDB search
MTIYINKDETVFHLAMKDSSYIFRILENGELQHLHFGKRIHVKENYNQLMAYEKRGFEVS
FSEEFEDIQQSMIQNEYSSYGKGDFRHPAFQVQGMNGSRITTLKYQGFELEKGKNRLNSL
PSTFDDIGQCAETLTIILTDSILDLTVRLNYTIFPEYNVLVRNTEFLNNSNNKLTLLKAM
SLQLDLPDSQYDFIQFSGAWLRERQLYRTSLRPGIQAIDSLRYSSSPQQNPFFMLSRRET
TEHSGEVYGFNFIYSGNFQNMIEVDHFDTARVTVGINPVEFRFLLNPAESFVTPEAIVIY
SDQGMNQMSQQLSDFYRHHLVNPNFSQASRPIILNSWETFYFDLGTEKILDLAKAAKDLG
IELFVLDDGWFGHRKDDKSSLGDWVTDRSRLPEGIGFLADEIHKIGLQFGLWFEPEMISI
DSDLYKNHADWTIHLLDREKSVGRNQYVLDLTRQEVVDYLFDSISKIIIKTNLDYIKWDM
NRHITDIYSIELDSEQQMEFGHRYILGLYQLLDRLITKFPSVLFESCSSGGGRFDLGLMY
YAPQAWTSDDTDPIERLKIQHGTSYGYSPSMMTAHVSISPNEQSRRQTSLDTRTNVAYFS
SFGYELDVTRLSVEEKEQVREQIQFYKKYRSLFQYGDFYRINSPFSCDSASWQVVSKDKC
QSILLYAQLNSKLNPGYTRVYFSGLDKDKCYSVSGFDEFFYGDELMNAGIKVSLSNLALC
VPEYLTKLFVIEEVVCK
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgacgatttatattaataaggacgagaccgtttttcatttggcaatgaaagatagtagt
tatatttttagaattttagaaaatggggaacttcaacatctacattttgggaaaaggatt
catgtcaaggaaaattataaccaattgatggcctatgaaaaaagaggatttgaagtatct
ttttctgaagaatttgaggatattcaacagtctatgatacaaaatgaatattcttcatat
gggaaaggagattttcggcatccagcctttcaagttcaaggaatgaatggtagtaggata
acgacactaaaatatcaaggttttgaacttgaaaaagggaaaaatcgtcttaactctcta
ccttcaacatttgatgatattggtcagtgtgcggaaacattaacgattattttaacagat
tccatattagatttaactgttagactaaattacacaatttttccggaatacaatgtctta
gttagaaatacggaatttttaaataatagcaataataagttgactcttttgaaagcaatg
agcttacagctagatctacctgatagtcaatatgactttattcaattttctggagcatgg
ctgagggaacgtcagttatatagaacttcgcttagaccaggtattcaagcaatagatagc
ttgagatactcatcaagtcctcagcaaaatcctttctttatgctatcaaggagggaaact
acagagcatagtggtgaggtttatggttttaactttatctattctggaaattttcaaaat
atgattgaagttgaccattttgacaccgctagagtaacggtaggaataaatccagtagaa
tttcgttttttattaaatcctgccgaaagttttgtgacaccagaagcaattgtgatctat
tctgatcaagggatgaatcagatgagccaacaactatcagatttttatcgacatcattta
gttaatcctaatttttctcaagctagtcgtcctataatactcaatagttgggaaacattt
tattttgacttgggtacagaaaaaattttagatttagcaaaggctgctaaagatttaggg
atagaattatttgtactggatgatggttggtttggtcataggaaagatgacaaaagttct
ctgggggattgggtaacagatagaagtcgccttcctgaaggtattggatttcttgcagat
gaaattcacaaaataggtttacaatttggtttgtggtttgagcctgaaatgatttctatt
gatagtgatttgtacaagaatcatgccgattggactatccatttgttagacagagagaag
tcagtaggaagaaatcaatatgtgttggatttgacgagacaggaagttgttgattacctt
tttgattctatttctaaaatcataatcaaaacaaatctggattatatcaaatgggatatg
aatcgtcatataacagatatttatagtattgaacttgattctgaacagcagatggaattt
ggtcatcgatatatcttaggtctttatcagttattagatcgtttaataactaagttccct
tcagttctatttgaatcttgttcttcaggtggtggacgttttgatttaggacttatgtat
tatgcaccgcaagcgtggacgagtgatgatacggacccgatagaaagattgaaaattcag
catggaacttcttatggatattctccatcaatgatgacagcccatgtttctatttctcca
aatgaacaaagtagaagacaaacgagtttggacactaggacaaatgtagcttattttagt
tctttcggttatgaattagatgttacgagattgtcggtagaagaaaaagaacaagtgaga
gaacaaattcagttttataaaaaatatcgttcattgtttcaatatggggatttctatagg
ataaacagtccttttagttgtgattctgctagttggcaagttgtttcaaaagataaatgc
caatcgattttattgtatgctcaattgaatagtaagttgaatccaggttatacaagagtt
tattttagtggtttagataaagataaatgctattccgtctctggatttgatgagttcttt
tatggagatgaattaatgaatgctggaataaaagtcagtttaagtaatttagcactatgt
gttccagaatatcttacaaaattatttgttattgaggaagttgtatgtaaataa

DBGET integrated database retrieval system