KEGG   Streptococcus pneumoniae 670-6B: SP670_2306Help
Entry
SP670_2306        CDS       T01308                                 

Definition
alpha-galactosidase AgaN
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
snb  Streptococcus pneumoniae 670-6B
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:snb00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SP670_2306
  Lipid metabolism
   00561 Glycerolipid metabolism
    SP670_2306
   00600 Sphingolipid metabolism
    SP670_2306
Enzymes [BR:snb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SP670_2306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2156035..2158248)
Genome map
AA seq 737 aa AA seqDB search
MTIYINKDETVFHLAMKDSSYIFRILENGELQHLHFGKRIHVKENYNQLMAYEKRGFEVS
FSEEFEDIQQSMIQNEYSSYGKGDFRHPAFQVQGMNGSRITTLKYQGFELEKGKNRLNSL
PSTFDDIGQCAETLTIILTDSILDLTVRLNYTIFPEYNVLVRNTEFLNNSNNKLTLLKAM
SLQLDLPDSQYDFIQFSGAWLRERQLYRTSLRPGIQAIDSLRYSSSPQQNPFFMLSRRET
TEHSGEVYGFNFIYSGNFQNMIEVDHFDTARVTVGINPVEFRFLLNPAESFVTPEAIVIY
SDQGMNQMSQQLSDFYRHHLVNPNFSQASRPIILNSWETFYFDLGTEKILDLAKAAKDLG
IELFVLDDGWFGHRKDDKSSLGDWVTDRSRLPEGIGFLADEIHKIGLQFGLWFEPEMISI
DSDLYKNHADWTIHLLDREKSVGRNQYVLDLTRQEVVDYLFDSISKIIIKTNLDYIKWDM
NRHITDIYSIELDSEQQMEFGHRYILGLYQLLDRLITKFPSVLFESCSSGGGRFDLGLMY
YAPQAWTSDDTDPIERLKIQHGTSYGYSPSMMTAHVSISPNEQSRRQTSLDTRTNVAYFS
SFGYELDVTRLSVEEKEQVREQIQFYKKYRSLFQYGDFYRINSPFSCDSASWQVVSKDKC
QSILLYAQLNSKLNPGYTRVYFSGLDKDKCYSVSGFDEFFYGDELMNAGIKVSLSNLALC
VPEYLTKLFVIEEVVCK
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgacgatttatattaataaggacgagaccgtttttcatttggcaatgaaagatagtagt
tatatttttagaattttagaaaatggggaacttcaacatctacattttgggaaaaggatt
catgtcaaggaaaattataaccaattgatggcctatgaaaaaagaggatttgaagtatct
ttttctgaagaatttgaggatattcaacagtctatgatacaaaatgaatattcttcatat
gggaaaggagattttcggcatccagcctttcaagttcaaggaatgaatggtagtaggata
acgacactaaaatatcaaggttttgaacttgaaaaagggaaaaatcgtcttaactctcta
ccttcaacatttgatgatattggtcagtgtgcggaaacattaacgattattttaacagat
tccatattagatttaactgttagactaaattacacaatttttccggaatacaatgtctta
gttagaaatacggaatttttaaataatagcaataataagttgactcttttgaaagcaatg
agcttacagctagatctacctgatagtcaatatgactttattcaattttctggagcatgg
ctgagggaacgtcagttatatagaacttcgcttagaccaggtattcaagcaatagatagc
ttgagatactcatcaagtcctcagcaaaatcctttctttatgctatcaaggagggaaact
acagagcatagtggtgaggtttatggttttaactttatctattctggaaattttcaaaat
atgattgaagttgaccattttgacaccgctagagtaacggtaggaataaatccagtagaa
tttcgttttttattaaatcctgccgaaagttttgtgacaccagaagcaattgtgatctat
tctgatcaagggatgaatcagatgagccaacaactatcagatttttatcgacatcattta
gttaatcctaatttttctcaagctagtcgtcctataatactcaatagttgggaaacattt
tattttgacttgggtacagaaaaaattttagatttagcaaaggctgctaaagatttaggg
atagaattatttgtactggatgatggttggtttggtcataggaaagatgacaaaagttct
ctgggggattgggtaacagatagaagtcgccttcctgaaggtattggatttcttgcagat
gaaattcacaaaataggtttacaatttggtttgtggtttgagcctgaaatgatttctatt
gatagtgatttgtacaagaatcatgccgattggactatccatttgttagacagagagaag
tcagtaggaagaaatcaatatgtgttggatttgacgagacaggaagttgttgattacctt
tttgattctatttctaaaatcataatcaaaacaaatctggattatatcaaatgggatatg
aatcgtcatataacagatatttatagtattgaacttgattctgaacagcagatggaattt
ggtcatcgatatatcttaggtctttatcagttattagatcgtttaataactaagttccct
tcagttctatttgaatcttgttcttcaggtggtggacgttttgatttaggacttatgtat
tatgcaccgcaagcgtggacgagtgatgatacggacccgatagaaagattgaaaattcag
catggaacttcttatggatattctccatcaatgatgacagcccatgtttctatttctcca
aatgaacaaagtagaagacaaacgagtttggacactaggacaaatgtagcttattttagt
tctttcggttatgaattagatgttacgagattgtcggtagaagaaaaagaacaagtgaga
gaacaaattcagttttataaaaaatatcgttcattgtttcaatatggggatttctatagg
ataaacagtccttttagttgtgattctgctagttggcaagttgtttcaaaagataaatgc
caatcgattttattgtatgctcaattgaatagtaagttgaatccaggttatacaagagtt
tattttagtggtttagataaagataaatgctattccgtctctggatttgatgagttcttt
tatggagatgaattaatgaatgctggaataaaagtcagtttaagtaatttagcactatgt
gttccagaatatcttacaaaattatttgttattgaggaagttgtatgtaaataa

DBGET integrated database retrieval system