KEGG   Streptococcus pneumoniae 670-6B: SP670_2332Help
Entry
SP670_2332        CDS       T01308                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
snb  Streptococcus pneumoniae 670-6B
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:snb00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2184581..2186089)
Genome map
AA seq 502 aa AA seqDB search
MSQEKYIMAIDQGTTSSRAIIFNKKGEKVSSSQKEFTQIFPQAGWVEHNANEIWNSVQSV
IAGAFIESGVKPNQIEAIGITNQRETTVVWDKKTGLPIYNAIVWQSRQTAPLAEQLKSQG
YVEKFHEKTGLIIDAYFSATKVRWILDHVEGAQERAEKGELLFGTIDTWLVWKLTDGAAH
VTDYSNAARTMLYNIKELKWDDEILEILNIPKAILPEVRSNSEIYGKTAPFHFYGGEVPI
SGMAGDQQAALFGQLAFEPGMVKNTYGTGSFIIMNTGEEMQLSENNLLTTIGYGINGKVY
YALEGSIFIAGSAIQWLRDGLRMVENSPESEKYARDSHNNDEVYVVPAFTGLGAPYWNQN
ARGSVFGLTRGTSKEDFIKATLQSIAYQVRDIIDTMQVDTQTAIQVLKVDGGAAMNNFLM
QFQADILGIDIARAKNLETTALGAAFLAGLSVGYWKDLDELKLLNETGELFEPSMNESRK
EQLYKGWKKAVKATQVFAEVDD
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaagaaaaatacatcatggccattgaccagggaactacaagttctcgtgccatc
attttcaacaaaaaaggggaaaaggttagctcgagtcaaaaagagtttacccagattttc
cctcaggcaggttgggttgagcacaatgccaatgaaatttggaactctgttcagtcagtt
attgcgggtgctttcatcgaaagtggcgtcaagccaaatcaaatcgaggcaatcgggatt
accaaccaacgtgaaacaacggttgtctgggataagaaaacaggacttcctatctacaat
gctatcgtttggcagtcacgccagacagcacctttggctgagcaactaaaaagccaaggt
tatgtggaaaaattccatgaaaagactggtttgattattgatgcttacttctctgctacc
aaggttcgttggattttggatcatgtagaaggcgctcaagagcgagcagaaaaaggggaa
ttgctctttggtactatcgatacttggttggtttggaaattgactgacggtgcggctcac
gtgactgactactcaaatgcagctcgtaccatgctttataacattaaagaactcaaatgg
gatgatgagattttggaaatccttaacattccgaaggctatacttccagaagttcgttct
aactccgaaatctacggcaagacagctccattccatttctacggtggagaggtgccaatc
tcaggtatggctggggaccaacaagcagccctctttggacagttggcttttgagccaggt
atggttaagaatacttatggaacaggctctttcatcatcatgaatactggggaagagatg
cagttgtctgaaaacaacctcttgacaaccattggttacggaatcaacggtaaggtttat
tatgccttggaaggttctatcttcatcgcaggaagtgctattcagtggcttcgtgacggt
cttcgcatggttgaaaattcaccagaatctgaaaaatacgctcgtgattctcacaacaac
gatgaagtttatgtcgttccagcctttacaggtctaggcgctccatattggaaccaaaat
gctcgtggttccgtctttggtttgactcgtggaacaagcaaagaagactttatcaaggcg
actttgcaatctattgcttatcaagtgcgtgacatcatcgacaccatgcaagtggatact
cagactgccattcaagtattgaaggtggatggtggtgcagccatgaacaacttcctcatg
cagttccaggcggatattttaggcattgatattgcacgtgctaaaaacttggaaacaaca
gctctaggagcggccttcctagcaggtttatcagtagggtactggaaagacttggacgag
ttgaaactcttgaacgagacaggagaactctttgagccatctatgaatgaatctcgcaag
gaacaactctacaagggctggaagaaggctgtgaaagcaactcaagtctttgcggaagta
gacgactaa

DBGET integrated database retrieval system