KEGG   Streptococcus pneumoniae TCH8431/19A: HMPREF0837_10020Help
Entry
HMPREF0837_10020  CDS       T01259                                 

Gene name
adhE
Definition
alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
snc  Streptococcus pneumoniae TCH8431/19A
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:snc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    HMPREF0837_10020 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0837_10020 (adhE)
   00620 Pyruvate metabolism
    HMPREF0837_10020 (adhE)
   00650 Butanoate metabolism
    HMPREF0837_10020 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    HMPREF0837_10020 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    HMPREF0837_10020 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HMPREF0837_10020 (adhE)
   00626 Naphthalene degradation
    HMPREF0837_10020 (adhE)
Enzymes [BR:snc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     HMPREF0837_10020 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     HMPREF0837_10020 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(17127..19790)
Genome map
AA seq 887 aa AA seqDB search
MEENMADKKTVTPEEKKLVAEKHVDELVQKALVALEEMRKLDQEQVDYIVAKASVAALDA
HGELALHAFEETGRGVFEDKATKNLFACEHVVNNMRHTKTVGVIEEDDVTGLTLIAEPVG
VVCGITPTTNPTSTAIFKSLISLKTRNPIVFAFHPSAQESSAHAARIVRDAAIAAGAPEN
CVQWITQPSMEATSALMNHEGVATILATGGNAMVKAAYSCGKPALGVGAGNVPAYVEKSA
NIRQAAHDIVMSKSFDNGMVCASEQAVIIDKEIYDEFVAEFKSYHTYFVNKKEKALLEEF
CFGVKANSKNCAGAKLNADIVGKPATWIAEQAGFTVPEGTNILAAECKEVGENEPLTREK
LSPVIAVLKSESREDGITKARQMVEFNGLGHSAAIHTADEELTKEFGKAVKAIRVICNSP
STFGGIGDVYNAFLPSLTLGCGSYGRNSVGDNVSAINLLNIKKVGRRRNNMQWMKLPSKT
YFERDSIQYLQKCRDVERVMIVTDHAMVELGFLDRIIEQLDLRRNKVVYQIFADVEPDPD
ITTVNRGTEIMRAFKPDTIIALGGGSPMDAAKVMWLFYEQPEVDFRDLVQKFMDIRKRAF
KFPLLGKKTKFIAIPTTSGTGSEVTPFAVISDKANNRKYPIADYSLTPTVAIVDPALVLT
VPGFVAADTGMDVLTHATEAYVSQMASDYTDGLALQAIKLVFENLESSVKNADFHSREKM
HNASTIAGMAFANAFLGISHSMAHKIGAQFHTIHGRTNAILLPYVIRYNGTRPAKTATWP
KYNYYRADEKYQDIARMLGLPASTPEEGVESYAKAVYELGERIGIQMNFRDQGIDEKEWK
EHSRELAFLAYEDQCSPANPRLPMVDHMQEIIEDAYYGYKERPGRRK
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaaatatggctgataaaaaaactgtgacaccagaggaaaagaaactcgttgct
gaaaaacacgtagatgagttggttcaaaaagctctagttgcccttgaagaaatgcgtaaa
ttggatcaagaacaagttgactacatcgttgccaaagcatcagtagcagctttggatgcc
cacggagaattggctttacatgcctttgaagaaacaggacgtggtgtatttgaagacaaa
gcaactaagaacttgtttgcctgtgaacacgtagtaaacaacatgcgccacactaagaca
gttggcgttatcgaagaagacgatgtaacaggattgactcttattgctgaaccagttggt
gttgtttgtggtattactccaacaacaaacccaacatcaacagcaatcttcaaatcattg
atttcattgaagacacgtaacccaatcgtctttgccttccatccatcagcacaagaatca
tctgctcatgcagctcgtatcgtccgcgatgcagctatcgcagctggtgctcctgaaaac
tgtgtgcaatggattactcaaccatctatggaagcaacaagtgcccttatgaaccacgaa
ggtgttgcgacaatccttgcaacaggtggtaatgccatggttaaggcggcttattcatgt
ggtaaaccagctcttggggtaggtgccggaaacgttccagcttatgttgaaaaatcagca
aacattcgtcaagcagcacacgatatcgtcatgtctaaatcatttgataacggtatggtc
tgtgcatctgaacaagcagttatcattgataaagaaatttacgatgaatttgtagcagag
ttcaaatcttaccacacttactttgtaaacaaaaaagaaaaagctcttcttgaagagttc
tgcttcggcgtcaaagcaaacagcaaaaactgtgctggtgcaaaattgaacgctgacatc
gttggtaaaccagcaacttggattgcagaacaagcaggatttacagttccagaaggaaca
aacattcttgctgcagaatgtaaagaagttggcgaaaatgagccattgactcgtgaaaaa
ttgtcaccagttattgcagttttgaaatctgaaagccgtgaagatggtattactaaggct
cgtcaaatggttgaatttaacggtcttggacactcagcagctatccacacagctgacgaa
gaattgactaaagaatttggtaaagctgttaaagctattcgtgttatctgtaactcacct
tctacttttggtggtatcggggacgtttacaatgccttcttgccatcattgacacttgga
tgtggttcttacggacgcaactcagttggggataacgttagtgccattaacctcttgaat
atcaaaaaagtcggaagacggagaaataacatgcaatggatgaaacttccttcaaaaaca
tactttgaacgtgattcaattcaataccttcaaaaatgtcgtgacgttgaacgtgtcatg
atcgttactgaccatgccatggtagagcttggtttccttgatcgtatcatcgaacaactg
gaccttcgtcgcaataaggttgtttaccaaatctttgcggatgtagaaccggatccagat
atcacaactgtaaaccgtggtactgagattatgcgtgccttcaaaccagataccatcatc
gcactcggtggtgggtctccaatggatgctgccaaagtaatgtggctcttctacgagcaa
ccagaagtggacttccgtgaccttgtccaaaaattcatggatatccgtaaacgtgccttc
aagttcccattgcttggtaagaagactaaattcatcgcgattccaactacatctggtaca
ggatctgaagtaacaccatttgccgttatctctgataaagcaaacaaccgtaaataccca
atcgctgactactcattgacaccaactgtggcaatcgtagatcctgctttggtattgaca
gttccaggatttgttgctgctgatactggtatggacgtattgactcacgcgacagaagca
tacgtatcacaaatggctagtgactacactgatggtttagcacttcaagccattaaattg
gtctttgaaaatctcgaaagctcagttaagaatgcagacttccactcacgtgagaaaatg
cataacgcttcaacaatcgctggtatggcctttgccaatgccttcctaggtatttctcac
tcaatggcccataagattggtgcgcaattccacacaatccacggtcgtacaaatgccatc
ttgcttccatacgttatccgttacaacggtacacgtccagctaagacagcaacatggcct
aagtacaactactaccgtgcagatgaaaaataccaagatatcgcacgcatgcttggactt
ccagcttctactccagaagaaggggttgaatcttacgcaaaagctgtctacgaactcggt
gaacgtattgggatccaaatgaattttagagaccaaggaattgacgaaaaagaatggaaa
gaacattctcgtgaattagccttcctggcttatgaagaccaatgttcaccagctaaccca
cgtcttccaatggtagaccatatgcaagaaatcatcgaagatgcatactatggctacaaa
gaaagaccaggacgccgtaaataa

DBGET integrated database retrieval system