KEGG   Streptococcus pneumoniae TCH8431/19A: HMPREF0837_10067Help
Entry
HMPREF0837_10067  CDS       T01259                                 

Gene name
gltX
Definition
glutamate--tRNA ligase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
snc  Streptococcus pneumoniae TCH8431/19A
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:snc00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    HMPREF0837_10067 (gltX)
Enzymes [BR:snc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     HMPREF0837_10067 (gltX)
Amino acid related enzymes [BR:snc01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   HMPREF0837_10067 (gltX)
Transfer RNA biogenesis [BR:snc03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    HMPREF0837_10067 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(63012..64472)
Genome map
AA seq 486 aa AA seqDB search
MSKDIRVRYAPSPTGLLHIGNARTALFNYLYARHHGGTFLIRIEDTDRKRHVEDGERSQL
ENLRWLGMDWDESPESHENYRQSERLDLYQKYIDQLLAEGKAYKSYVTEEELAAERERQE
VAGETPRYINEYLGMSEEEKAAYIAEREAAGIIPTVRLAVNESGIYKWHDMVKGDIEFEG
GNIGGDWVIQKKDGYPTYNFAVVIDDHDMQISHVIRGDDHIANTPKQLMVYEALGWEAPE
FGHMTLIINSETGKKLSKRDTNTLQFIEDYRKKGYLPEAVFNFIALLGWNPGGEDEIFSR
EELIKLFDENRLSKSPAAFDQKKLDWMSNDYIKNADLETIFEMAKPFLEEAGRLTDKAEK
LVELYKPQMKSVDEIIPLTDLFFSDFPELTEAEREVMTGETVPTVLEAFKAKLEAMTDDK
FVTENIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHGPELPDTIFLLGREKSIQHIENM
LKEISK
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagatatccgcgtacgttacgcaccaagtccaacaggactactacacatcgga
aatgctcgtacagcattgtttaattacttgtatgcgcgccatcatggtggaacatttctc
atccgtatcgaagatactgaccgtaaacgccatgtcgaggatggtgaacgttcacaactt
gaaaaccttcgctggttaggcatggattgggatgaaagtccagaatcacatgagaattat
cgccagtctgagcgtttagacttgtatcaaaaatacattgaccaactattagctgaagga
aaagcctataaatcttacgttacagaagaagagttggcagctgaacgcgaacgccaagaa
gtagctggcgaaacaccacgctacatcaatgaataccttggtatgagtgaagaagaaaaa
gcagcttacatcgcagaacgtgaagcagcagggatcatcccaactgttcgtttggctgtc
aatgagtcaggtatctacaagtggcatgatatggtcaaaggcgatatcgaatttgaaggt
ggcaatatcggtggtgactgggttatccaaaagaaagacggttacccaacttacaacttt
gccgttgttatcgatgaccacgatatgcaaatctctcatgttatccgtggagatgaccat
attgctaatacaccaaaacagcttatggtctatgaagctcttggttgggaagctccagag
ttcggtcacatgaccttgattatcaactctgagactggtaagaagttatctaaacgtgat
actaatacacttcaatttatcgaagattaccgaaagaaaggttaccttccagaagcagtc
tttaactttattgctcttcttggttggaacccaggtggtgaagatgagattttctctcgt
gaagaactcattaaactttttgatgaaaaccgcctcagcaagtcaccagcagcctttgat
cagaaaaaactagactggatgagcaatgattatatcaagaatgcagaccttgaaaccatc
tttgaaatggcaaaaccattcttagaggaagcaggccgtttgactgacaaggctgaaaaa
ttagttgagctctataaaccacaaatgaaatcagtagatgagattatcccattgacagat
cttttcttctcagatttcccagaattgacagaagcagagcgcgaagtcatgacgggtgaa
acagttccaacagttcttgaagcattcaaagcaaaacttgaagcgatgacagatgataaa
tttgtgacagaaaatatcttcccacaaattaaagcagttcaaaaagaaacaggtattaaa
gggaaaaatcttttcatgcctattcgtatcgcagtttcaggcgaaatgcatgggccagaa
ttaccagatacaattttcttgcttggacgtgaaaaatcaattcagcatatcgaaaacatg
ctaaaagaaatctctaaataa

DBGET integrated database retrieval system