KEGG   Streptococcus pneumoniae TCH8431/19A: HMPREF0837_10346Help
Entry
HMPREF0837_10346  CDS       T01259                                 

Gene name
strH
Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
snc  Streptococcus pneumoniae TCH8431/19A
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:snc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF0837_10346 (strH)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    HMPREF0837_10346 (strH)
Enzymes [BR:snc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     HMPREF0837_10346 (strH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(322970..326995)
Genome map
AA seq 1341 aa AA seqDB search
MTLVNIRNKIKALIYIIAINITMQSGGFAMKHEKQQRFSIRKYAVGAASVLIGFAFQAQT
VAADGVTPTTTENQPTIHTVSDSPQSSENRTEETPKAELQPEAPKTVETETPATDKVASL
PKTEEKPQEEVSSTPSDKAEVVTPTSAEKETANKKEEEASPKKEEAKEVDSKESNTDKTD
KDKPAKKDEAKAEADKPETETGKERAATVNEKLAKKKIVSIDAGRKYFSPEQLKEIIDKA
KHYGYTDLHLLVGNDGLRFMLDDMSITANGKTYASDDVKRAIEKGTNDYYNDPNGNHLTE
SQMTDLINYAKDKGIGLIPTVNSPGHMDAILNAMKELGIQNPNFSYFGKKSARTVDLDNE
QAVAFTKALIDKYAAYFAKKTEIFNIGLDEYANDATDAKGWSVLQADKYYPNEGYPVKGY
EKFIAYANDLARIVKSHGLKPMAFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVASS
KLLAEKGHQILNTNDAWYYVLGRNADGQGWYNLDQGLNGIKNTPITSVPKTEGADIPIIG
GMVAAWADTPSARYSPSHLFKLMRHFANANAEYFAADYESAEQALNEVPKDLNRYTAESV
AAVKEAEKAIRSLDSNLSRAQQDTIDQAIAKLQETVNNLTLTPEAQKEEEAKREVEKLAK
NKVISIDAGRKYFTLNQLKRIVDKASELGYSDVHLLLGNDGLRFLLDDMTITANGKTYAS
DDVKKAIIEGTKAYYDDPNGTALTQAEVTELIEYAKSKDIGLIPAINSPGHMDAMLVAME
KLGIKNPQAHFDKVSKTTMDLKNEEAMNFVKALIGKYMDFFAGKTKIFNFGTDEYANDAT
SAQGWYYLKWYQLYGKFAEYANTLAAMAKERGLQPMAFNDGFYYEDKDDVQFDKDVLISY
WSKGWWGYNLASPQYLASKGYKFLNTNGDWYYILGQKPEDGGGFLKKAIENTGKTPFNQL
ASTKYPEVDLPTVGSMLSIWADRPSAEYKEEEIFELMTAFADHNKDYFRANYNALREELA
KIPTNLEGYSKESLEALDAAKTALNYNLNRNKQAELDTLVANLKAALQGLKPAATHSGSL
DENEVAANVETRPELITRTEEIPFEVIKKENPNLPAGQENIITAGVKGERTHYISVLTEN
GKTTETVLDSQVTKEVINQVVEVGAPVTHKGDESGLAPTTEVKPRLDIQKEEIPFTTVTR
ENPLLLKGKTQVITKGVNGHRSNFYSVSTSADGKEVKTLVNSVVAQEAVTQIVEVGTMVT
HVGDENGQAAIAEEKPKLEIPSQPAPSTAPAEESKALPQDPAPVVIEKKLPETGTHDSAG
LVVAGLMATLAAYGLTKRKED
NT seq 4026 nt NT seq  +upstreamnt  +downstreamnt
ttgactctcgttaatataagaaataaaataaaggcgttgatttatataatcgctatcaat
ataacaatgcaatcaggaggttttgcaatgaaacatgaaaaacaacagcgtttttctatt
cgtaaatacgctgtaggagcagcttctgttctaattggatttgccttccaagcacagact
gttgcagccgatggagttactcctactactacagaaaaccaaccgaccatccatacggtt
tctgattcccctcaatcatccgaaaatcggactgaggaaacacctaaagcagagcttcaa
ccagaagctccaaaaactgtagaaacagaaactccagctactgataaggtagctagtctt
ccaaaaacagaagaaaaaccacaagaggaagttagttcaactcctagtgataaagcagag
gtggtaactccaacttctgctgaaaaagaaactgctaataaaaaggaagaagaagctagc
cctaaaaaggaagaagcgaaagaggttgattctaaagagtcaaatacagacaagactgac
aaggataaaccagctaaaaaagatgaagcgaaagcagaggctgacaaaccggaaacagag
acaggaaaggaacgtgctgcaactgtaaatgaaaaactagcgaaaaagaaaattgtttct
attgatgctggacgtaaatatttctcaccagaacagctcaaggaaatcatcgataaagcg
aaacattatggctacactgatttacacctattagtcggaaatgatggactccgtttcatg
ttggacgatatgagcatcacagctaacggcaagacctatgccagtgacgatgtcaaacgc
gccattgaaaaaggtacaaatgattattacaacgatccaaacggcaatcacttaacagaa
agtcaaatgacagatctgattaactatgccaaagataaaggtatcggtctcattccgaca
gtaaatagtcctggacacatggatgcgattctcaatgccatgaaagaattgggaatccaa
aaccctaactttagctattttgggaagaaatcagcccgtactgtcgatcttgacaacgaa
caagctgtcgcttttacaaaagcccttatcgacaagtatgctgcttatttcgcgaaaaag
actgaaatcttcaacatcggacttgatgaatatgccaatgatgcgacagatgctaaaggt
tggagtgtgcttcaagctgataaatactatccaaacgaaggctaccctgtaaaaggctat
gaaaaatttattgcctacgccaatgacctcgctcgtattgtaaaatcgcacggtctcaaa
ccaatggcctttaacgacggtatctactacaatagcgacacaagctttggtagttttgac
aaagacatcatcgtttctatgtggactggtggttggggaggctacgatgtcgcttcttct
aaactactagctgaaaaaggtcaccaaatccttaataccaatgatgcttggtactacgtt
cttggacgaaacgctgatggccaaggctggtacaatctcgatcaggggctcaatggtatt
aaaaacacaccaatcacttctgtaccaaaaacagaaggagctgatatcccaatcatcggt
ggtatggtagctgcttgggctgacactccatctgcacgttattcaccatcacacctcttc
aaactcatgcgtcattttgcaaatgccaacgctgaatacttcgcagctgattatgaatct
gcagagcaagcacttaacgaggtaccaaaagacctgaaccgttatactgcagaaagcgtc
gcggccgtaaaagaagctgaaaaagctattcgctctctcgatagcaaccttagccgtgcc
caacaagatacgattgatcaagccattgctaaacttcaagaaactgtcaacaacttgacc
ctcacgcctgaagctcaaaaagaagaagaagctaaacgtgaggttgaaaaacttgccaaa
aacaaggtaatctcaatcgatgctggacgcaaatactttactctgaaccagctcaaacgc
atcgtagacaaggccagtgagctcggatattctgatgtccatctccttctaggaaatgac
ggacttcgctttctactcgatgatatgaccattactgccaacggaaaaacctatgctagt
gatgacgttaaaaaagctattatcgaaggaactaaagcttactacgacgatccaaacggt
actgcactaacacaggcagaagtaacagagctaattgaatacgctaaatctaaggacatc
ggtctcatcccagctattaacagtccaggtcacatggatgctatgctggttgccatggaa
aaattaggtattaaaaatcctcaagcccactttgataaagtttcaaaaacaactatggac
ttgaaaaacgaagaagcgatgaactttgtaaaagccctcatcggtaaatacatggacttc
tttgcaggtaaaacaaagattttcaactttggtactgacgaatacgccaacgatgcgact
agtgcccaaggctggtactacctcaagtggtatcaactctatggcaaatttgccgaatat
gccaacaccctcgcagctatggccaaagaaagagggcttcaaccaatggccttcaacgat
ggcttctactatgaagacaaggacgatgttcagtttgacaaagatgtcttgatttcttac
tggtctaaaggctggtggggatataacctcgcatcacctcaatacctagcaagcaaaggc
tataaattcttgaataccaacggtgactggtactacattcttggtcaaaaaccagaagat
ggtggtggtttcctcaagaaagctattgagaatactggaaaaacaccattcaatcaacta
gcttctaccaaatatcctgaagtagatcttccaacagtcggaagtatgctttcaatctgg
gcagatagaccaagcgctgaatacaaggaagaggaaatctttgaactcatgactgccttt
gcagaccacaacaaagactacttccgtgctaattataatgctctccgcgaagaattagct
aaaattcctacaaacttagaaggatatagtaaagaaagtcttgaggcccttgacgcagct
aaaacagctctaaattacaacctcaaccgtaataaacaagctgagcttgacacacttgta
gccaacctaaaagccgctcttcaaggcctcaaaccagctgcaactcattcaggaagcctg
gatgaaaatgaagtggctgccaatgttgaaaccagaccagaactcatcacaagaactgaa
gaaattccatttgaagttatcaagaaagaaaatcctaacctcccagctggtcaggaaaat
attatcacagcaggagtcaaaggtgagcgaactcattacatctctgtactcactgaaaat
ggaaaaacaacagaaacagtccttgatagccaggtaaccaaagaagttataaaccaagtg
gttgaagttggcgctcctgtaactcacaagggtgatgaaagtggtcttgcaccaactact
gaggtaaaacctagactggatatccaaaaagaagaaattccatttaccacagtgactcgt
gaaaatccactcttactcaaaggaaaaacacaagtcattactaagggcgtcaatggacat
cgtagcaacttctactctgtgagcacttctgccgatggtaaggaagtgaaaacacttgta
aatagtgtcgtagcacaggaagccgttactcaaatagtcgaagtcggaactatggtaaca
catgtaggcgatgaaaacggacaagccgctattgctgaagaaaaaccaaaactagaaatc
ccaagccaaccagctccatcaactgctcctgctgaggaaagcaaagctcttcctcaagat
ccagctcctgtggtaatagagaaaaaacttcctgaaacaggaactcacgattctgcagga
ctagtagtcgcaggactcatggccacactagcagcctatggactcactaaaagaaaagaa
gactaa

DBGET integrated database retrieval system