KEGG   Streptococcus pneumoniae TCH8431/19A: HMPREF0837_10479Help
Entry
HMPREF0837_10479  CDS       T01259                                 

Gene name
ruvC
Definition
crossover junction endoribonuclease subunit A (EC:3.1.22.4)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
snc  Streptococcus pneumoniae TCH8431/19A
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:snc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
435246..435839
Genome map
AA seq 197 aa AA seqDB search
MYAYLKGIITKITAKYIVLETNGIGYILHVANPYAYSGQVNQEDQIYVHQVVREDAHLLY
GFRSEDEKKLFLSLISVSGIGPVSALAIIAADDNAGLVQAIETKNITYLTKFPKIGKKTA
QQMVLDLEGKVVVAGDDLPAKIAVQASAENQELEEAMEAMLALGYKATELKKIKKFFEGT
TDTAENYIKSALKMLVK
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcatatttaaaaggaatcattaccaaaattactgccaaatacattgttcttgaa
accaatggtattggttatatcctgcatgtggccaatccttatgcctattcaggtcaggtt
aatcaggaggatcagatttatgtgcatcaggttgtgcgtgaggacgcccatttgctttat
ggatttcgctcagaggatgagaaaaagctctttcttagtctgatttcggtctctgggatt
ggtcctgtatcagctcttgctattatcgctgctgatgacaatgctggcttggttcaagcc
attgaaaccaagaacatcacctacttgaccaagttccctaaaattggcaagaaaacagcc
cagcagatggtgctggacttggaaggcaaggtagtagttgcaggagatgaccttcctgcc
aagatcgcagtgcaagcaagtgctgaaaaccaagaattggaagaagctatggaagccatg
ttggctctgggctacaaggcaacagagctcaagaaaatcaagaaattctttgaaggaacg
acagatacagctgagaactatatcaagtcggcccttaaaatgttggtcaaatag

DBGET integrated database retrieval system