KEGG   Streptococcus pneumoniae TCH8431/19A: HMPREF0837_10605Help
Entry
HMPREF0837_10605  CDS       T01259                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
snc  Streptococcus pneumoniae TCH8431/19A
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:snc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
542942..543922
Genome map
AA seq 326 aa AA seqDB search
MVKSLEGVTDMLSKTNHAKTAICGIINVTPDSFSDGGQFFTLEQALQQARKLIAEGASML
DIGGESTRPGSSYVEIEIEEEIQRVVPVIKAIRKESDVLISIDTWKSQVAEAALAAGANL
VNDITGLMGDEKMAHVVANAGAKVVIMFNPVMARPQHPSSLIFPHFGFGQAFTEEELADF
EKMPIEELMEAFFERALARAEEAGIAPENILLDPGIGFGLTKKENLLLLRDLDKLHQKGY
PIFLGVSRKRFVINILEESGFEVNPETELGFHNRDTASAHVTSIAARQGVEVVRVHDVAS
HRMAVEIASAIRLADEAENLDLKQYK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaaagccttgagggagtgaccgatatgttaagtaaaaccaatcatgcaaagaca
gctatttgcggaattatcaatgtaaccccagactccttttcggatggtggtcaatttttt
acgcttgagcaagcgctccagcaggctcgtaaattgatagcagaaggagccagcatgcta
gatatcggtggagaatcaactcggccgggaagtagctatgttgagatagaaatagaagag
gaaatccagcgtgttgttccagtgattaaagcgattcgcaaggaaagtgatgtcctcatt
tccattgatacttggaaaagtcaggtggcagaggctgctttggctgctggtgccaatcta
gtcaatgatatcactggtctcatgggtgatgaaaaaatggcccatgtggttgctaatgct
ggtgcgaaagtagtcatcatgtttaatccagtcatggctcgacctcagcaccctagctcg
ctcatatttcctcattttggttttggacaagcttttacagaggaagagttagctgacttt
gaaaaaatgccaatcgaagaattgatggaggctttctttgaacgagcactagcgagagca
gaggaagctggtattgcaccagaaaatatcctcttggatccaggaattggctttggtttg
accaagaaagaaaatctgcttcttttacgggacctggataaactacatcagaagggctat
ccaatctttcttggagtgtcgcgcaagcgatttgtcatcaatatccttgaagaaagtggt
tttgaagtcaatcctgagacggaacttggtttccacaatcgagatacggcttcggctcat
gtaactagtatcgctgcaagacaaggtgtagaagtggtgcgcgtgcatgatgtagctagt
cacaggatggcagttgaaattgcctccgccattcgtctggctgatgaagcggaaaattta
gatttaaaacaatataaataa

DBGET integrated database retrieval system