KEGG   Streptococcus pneumoniae TCH8431/19A: HMPREF0837_10607Help
Entry
HMPREF0837_10607  CDS       T01259                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
snc  Streptococcus pneumoniae TCH8431/19A
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HMPREF0837_10607 (folE)
Enzymes [BR:snc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     HMPREF0837_10607 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
545227..545781
Genome map
AA seq 184 aa AA seqDB search
MDTQKIEAAVKMIIEAVGENANREGLQETPARVARMYQEIFSGLGQTAEEHLSKSFEIID
DNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIPDGRVAGLSKLARTVEVYSKKPQIQERLN
IEVADALMDYLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTVARGLFETDKDLRDQAYR
LMGL
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggatacacaaaagattgaagcagctgtaaaaatgattatcgaggctgtaggagagaac
gctaatcgcgagggcttgcaggaaacacctgctcgtgtagcccgtatgtatcaagagatt
ttttcaggtcttggtcaaacagcagaggaacatttgtcaaaatcctttgaaattattgac
gataatatggtggtagaaaaggatatctttttccataccatgtgtgaacaccacttcttg
ccattttatggtagagcgcacattgcctacattccagatggtcgtgtggcaggcttgtct
aagctagcccgtacggttgaagtttattcgaaaaaaccacaaattcaagaacgtttgaat
atcgaagtggccgatgccttgatggactatctaggtgctaaaggagcctttgttgtcatt
gaggcggaacatatgtgtatgagtatgcgtggtgttagaaaaccaggcactgcaaccttg
acgacagtagctcgtggtctatttgaaacagataaggacctccgcgaccaagcttatcgt
ttaatggggctataa

DBGET integrated database retrieval system