KEGG   Streptococcus pneumoniae TCH8431/19A: HMPREF0837_10960Help
Entry
HMPREF0837_10960  CDS       T01259                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
snc  Streptococcus pneumoniae TCH8431/19A
Pathway
snc00010  Glycolysis / Gluconeogenesis
snc00052  Galactose metabolism
snc00500  Starch and sucrose metabolism
snc00520  Amino sugar and nucleotide sugar metabolism
snc00521  Streptomycin biosynthesis
snc01100  Metabolic pathways
snc01110  Biosynthesis of secondary metabolites
snc01120  Microbial metabolism in diverse environments
snc01130  Biosynthesis of antibiotics
snc01200  Carbon metabolism
Module
snc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
snc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:snc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0837_10960
   00052 Galactose metabolism
    HMPREF0837_10960
   00500 Starch and sucrose metabolism
    HMPREF0837_10960
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF0837_10960
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HMPREF0837_10960
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    HMPREF0837_10960
Enzymes [BR:snc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HMPREF0837_10960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: ADI69188
UniProt: D6ZRE9
Position
888384..889361
Genome map
AA seq 325 aa AA seqDB search
MKKENMMSQKIIGIDLGGTSIKFAILTTAGEIQGKWSIKTNILDEGSHIVDDMIESIQHR
LDLLGLAAADFQGIGMGSPGVVDRDKGTVIGAYNLNWKTLQPIKQKIEKALGIPFFIDND
ANVAALGERWMGAGDNQPDVVFMTLGTGVGGGIVAEGKLLHGVAGAAGELGHITVDFDQP
IACTCGKKGCLETVASATGIVNLTRRYADEYEGDAALKRLIDNGEEVTAKTVFDLAKEGD
DLALIVYRNFSRYLGIACANIGSILNPSTIVIGGGVSAAGEFLLQGVQKVYDENSFPQVR
TSTKLALATLGNDAGVIGAASLVLQ
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggagaatatgatgagtcaaaagattattgggattgaccttggcggaacttct
atcaaatttgcaatcttaacaacagcaggagaaatccaaggaaaatggtcaatcaagacc
aacattttggatgagggaagtcatatcgttgatgatatgattgagtctattcaacatcgt
ttggacttgcttggattggcagcagcggacttccaaggcattggaatgggatcaccaggt
gtggttgaccgtgacaaagggactgttatcggtgcctacaacttgaactggaaaaccctt
caaccaatcaaacaaaagattgaaaaagctttgggcattccatttttcatcgataatgat
gccaacgtagcagctcttggtgagcgctggatgggtgctggtgataaccaaccagatgtt
gtctttatgacactcggtactggtgttggtggtggtattgtcgcagaaggcaaattgctt
catggtgttgctggtgcagcaggtgaacttggtcatatcactgttgattttgaccaacca
attgcatgtacttgtggtaaaaaaggctgtcttgagacagtcgcttctgcaacaggaatt
gtcaatttgactcgtcgctatgccgatgaatacgaaggcgatgcagccttgaaacgcttg
attgataacggagaagaagtaactgctaagactgtctttgatctcgcaaaagaaggagac
gaccttgctttgattgtttaccgtaacttctcacgttacttgggaatcgcttgtgctaac
attggttcaatcctaaacccatcaacaatcgtcatcggtggtggtgtgtcagctgcggga
gaattccttctacaaggtgttcaaaaagtttacgatgaaaatagtttcccacaagtacgc
acatctactaaattagctcttgcaactctaggaaatgacgctggagttatcggagcagca
tcacttgtattgcaataa

DBGET integrated database retrieval system